Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | H7793_RS03890 | Genome accession | NZ_CP060642 |
| Coordinates | 734594..734776 (+) | Length | 60 a.a. |
| NCBI ID | WP_011184726.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain TSPY1312 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 698918..734776 | 734594..734776 | within | 0 |
Gene organization within MGE regions
Location: 698918..734776
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7793_RS03610 (H7793_03620) | - | 698936..699778 (+) | 843 | WP_024623416.1 | SGNH/GDSL hydrolase family protein | - |
| H7793_RS03615 (H7793_03625) | - | 699756..700343 (+) | 588 | WP_002989129.1 | YpmS family protein | - |
| H7793_RS03620 (H7793_03630) | - | 700442..700717 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| H7793_RS03625 (H7793_03635) | - | 700807..701949 (-) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| H7793_RS03630 (H7793_03640) | - | 702073..702591 (-) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| H7793_RS03635 (H7793_03645) | - | 702603..703358 (-) | 756 | WP_010922480.1 | helix-turn-helix domain-containing protein | - |
| H7793_RS03640 (H7793_03650) | - | 703561..703773 (+) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| H7793_RS03645 (H7793_03655) | - | 704043..704354 (+) | 312 | WP_010922478.1 | excisionase | - |
| H7793_RS03650 (H7793_03660) | - | 704356..704541 (+) | 186 | WP_023079923.1 | hypothetical protein | - |
| H7793_RS03655 | - | 704635..704904 (+) | 270 | WP_011106700.1 | replication protein | - |
| H7793_RS03660 (H7793_03665) | - | 705045..705431 (+) | 387 | WP_063632588.1 | DnaD domain-containing protein | - |
| H7793_RS03665 (H7793_03670) | - | 705412..705645 (+) | 234 | WP_002985387.1 | hypothetical protein | - |
| H7793_RS03670 (H7793_03675) | - | 705642..705782 (+) | 141 | WP_011017992.1 | hypothetical protein | - |
| H7793_RS03675 (H7793_03680) | - | 705791..706003 (+) | 213 | WP_063632587.1 | hypothetical protein | - |
| H7793_RS03680 (H7793_03685) | bet | 706024..706869 (+) | 846 | WP_063632586.1 | phage recombination protein Bet | - |
| H7793_RS03685 (H7793_03690) | - | 706879..707907 (+) | 1029 | WP_063632585.1 | DUF1351 domain-containing protein | - |
| H7793_RS03690 (H7793_03695) | - | 708103..708444 (+) | 342 | WP_011888757.1 | hypothetical protein | - |
| H7793_RS03695 (H7793_03700) | - | 708441..708953 (+) | 513 | WP_063632584.1 | hypothetical protein | - |
| H7793_RS03700 | - | 708940..709125 (+) | 186 | WP_011017985.1 | hypothetical protein | - |
| H7793_RS03705 (H7793_03705) | - | 709130..709399 (+) | 270 | WP_063632583.1 | hypothetical protein | - |
| H7793_RS03710 (H7793_03710) | - | 709403..709630 (+) | 228 | WP_063632582.1 | hypothetical protein | - |
| H7793_RS03715 (H7793_03715) | - | 709618..710100 (+) | 483 | WP_063632581.1 | class I SAM-dependent methyltransferase | - |
| H7793_RS03720 (H7793_03720) | - | 710278..710697 (+) | 420 | WP_003051720.1 | DUF1492 domain-containing protein | - |
| H7793_RS03725 (H7793_03725) | - | 710806..711150 (+) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| H7793_RS03730 (H7793_03730) | - | 711300..711656 (+) | 357 | WP_002994106.1 | hypothetical protein | - |
| H7793_RS03735 (H7793_03735) | - | 711653..712921 (+) | 1269 | WP_228629719.1 | hypothetical protein | - |
| H7793_RS03740 (H7793_03740) | - | 712914..714407 (+) | 1494 | WP_228629720.1 | hypothetical protein | - |
| H7793_RS03745 (H7793_03745) | - | 714413..714637 (+) | 225 | WP_002994100.1 | hypothetical protein | - |
| H7793_RS03750 (H7793_03750) | - | 714714..714866 (+) | 153 | WP_228629721.1 | hypothetical protein | - |
| H7793_RS03755 (H7793_03755) | - | 714859..715125 (+) | 267 | WP_002986828.1 | hypothetical protein | - |
| H7793_RS03760 (H7793_03760) | - | 715127..715363 (+) | 237 | WP_011888764.1 | hypothetical protein | - |
| H7793_RS03765 (H7793_03765) | - | 715445..716860 (+) | 1416 | WP_136020531.1 | terminase | - |
| H7793_RS03770 (H7793_03770) | - | 716942..717403 (+) | 462 | WP_010922462.1 | DUF4355 domain-containing protein | - |
| H7793_RS03775 (H7793_03775) | - | 717428..718339 (+) | 912 | WP_011528788.1 | phage major capsid protein | - |
| H7793_RS03780 (H7793_03780) | - | 718339..718539 (+) | 201 | WP_010922460.1 | hypothetical protein | - |
| H7793_RS03785 (H7793_03785) | - | 718549..718971 (+) | 423 | WP_021733479.1 | phage Gp19/Gp15/Gp42 family protein | - |
| H7793_RS03790 (H7793_03790) | - | 718931..719269 (+) | 339 | WP_011054681.1 | hypothetical protein | - |
| H7793_RS03795 (H7793_03795) | - | 719262..719498 (+) | 237 | WP_000032787.1 | hypothetical protein | - |
| H7793_RS03800 (H7793_03800) | - | 719499..719834 (+) | 336 | WP_021733481.1 | hypothetical protein | - |
| H7793_RS03805 (H7793_03805) | - | 719850..720440 (+) | 591 | WP_021733477.1 | hypothetical protein | - |
| H7793_RS03810 (H7793_03810) | - | 720451..720714 (+) | 264 | WP_010922455.1 | hypothetical protein | - |
| H7793_RS03815 (H7793_03815) | - | 720729..721100 (+) | 372 | WP_011054678.1 | DUF5361 domain-containing protein | - |
| H7793_RS03820 (H7793_03820) | - | 721100..721627 (+) | 528 | Protein_698 | hypothetical protein | - |
| H7793_RS03825 (H7793_03825) | - | 721800..722360 (+) | 561 | WP_011017973.1 | HNH endonuclease | - |
| H7793_RS03830 (H7793_03830) | - | 722568..724376 (+) | 1809 | WP_228629722.1 | hypothetical protein | - |
| H7793_RS03835 (H7793_03835) | - | 724373..725068 (+) | 696 | WP_002992579.1 | hypothetical protein | - |
| H7793_RS03840 (H7793_03840) | - | 725050..727023 (+) | 1974 | WP_168642169.1 | phage tail spike protein | - |
| H7793_RS03845 (H7793_03845) | - | 727023..728024 (+) | 1002 | WP_023079488.1 | hyaluronidase HylP | - |
| H7793_RS03850 (H7793_03850) | - | 728039..729823 (+) | 1785 | WP_228629723.1 | gp58-like family protein | - |
| H7793_RS03855 (H7793_03855) | - | 729835..730272 (+) | 438 | WP_011106643.1 | DUF1617 family protein | - |
| H7793_RS03860 (H7793_03860) | - | 730269..730886 (+) | 618 | WP_011184056.1 | DUF1366 domain-containing protein | - |
| H7793_RS03865 (H7793_03865) | - | 730896..731168 (+) | 273 | WP_002986916.1 | hypothetical protein | - |
| H7793_RS03870 (H7793_03870) | - | 731165..731392 (+) | 228 | WP_000609113.1 | phage holin | - |
| H7793_RS03875 (H7793_03875) | - | 731508..732710 (+) | 1203 | WP_010922095.1 | glucosaminidase domain-containing protein | - |
| H7793_RS03880 (H7793_03880) | speC | 732778..733485 (-) | 708 | WP_002988478.1 | streptococcal pyrogenic exotoxin SpeC | - |
| H7793_RS03885 (H7793_03885) | mf2 | 733596..734354 (-) | 759 | WP_011184727.1 | DNase Mf2 | - |
| H7793_RS03890 (H7793_03890) | prx | 734594..734776 (+) | 183 | WP_011184726.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6936.91 Da Isoelectric Point: 4.1954
>NTDB_id=477148 H7793_RS03890 WP_011184726.1 734594..734776(+) (prx) [Streptococcus pyogenes strain TSPY1312]
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=477148 H7793_RS03890 WP_011184726.1 734594..734776(+) (prx) [Streptococcus pyogenes strain TSPY1312]
ATGCTAACATACGACGAATTTAAACAAGCAATTGACAATGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAACAAGCAATTGACAATGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS8232 |
86.667 |
100 |
0.867 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
68.333 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
70 |
0.5 |