Detailed information NTG0047711

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: LLH_RS11760
• Genome accession: NC_017492
• Coordinates: 2258479..2258829 (-)
• Length: 116 a.a.
• NCBI ID: WP_050574401.1
• Uniprot ID: -
• Organism: Lactococcus cremoris subsp. cremoris A76
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
ICE	2252555..2260656	2258479..2258829	within	0

Gene organization within MGE regions

Location: 2252555..2260656

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LLH_RS11720 (llh_12275)	-	2254015..2254824 (-)	810	WP_011677177.1	metal ABC transporter permease	-
LLH_RS11725 (llh_12280)	-	2254817..2255554 (-)	738	WP_011677178.1	metal ABC transporter ATP-binding protein	-
LLH_RS11730 (llh_12285)	-	2255733..2256575 (-)	843	WP_011677179.1	metal ABC transporter solute-binding protein, Zn/Mn family	-
LLH_RS11735 (llh_12290)	-	2256572..2257009 (-)	438	WP_011677180.1	zinc-dependent MarR family transcriptional regulator	-
LLH_RS11740 (llh_12295)	comGG	2257089..2257388 (-)	300	WP_011677181.1	competence type IV pilus minor pilin ComGG	Machinery gene
LLH_RS11745	comGF	2257412..2257837 (-)	426	WP_014735174.1	competence type IV pilus minor pilin ComGF	Machinery gene
LLH_RS11750 (llh_12305)	comGE	2257821..2258057 (-)	237	WP_014573335.1	competence type IV pilus minor pilin ComGE	Machinery gene
LLH_RS14595 (llh_12310)	comGD	2258089..2258277 (-)	189	WP_014573336.1	hypothetical protein	Machinery gene
LLH_RS11760 (llh_12320)	comGC	2258479..2258829 (-)	351	WP_050574401.1	competence type IV pilus major pilin ComGC	Machinery gene
LLH_RS11765 (llh_12325)	comGB	2258874..2259899 (-)	1026	WP_050574400.1	competence type IV pilus assembly protein ComGB	Machinery gene
LLH_RS11770 (llh_12330)	-	2259799..2260620 (-)	822	Protein_2274	ATPase, T2SS/T4P/T4SS family	-

Sequence

Protein

• Length: 116 a.a.
• Molecular weight: 13289.44 Da
• Isoelectric Point: 7.2003

>NTDB_id=47711 LLH_RS11760 WP_050574401.1 2258479..2258829(-) (comGC) [Lactococcus cremoris subsp. cremoris A76]
MSKALSLIKIHGRKLWQKKQKAFTLIEMLIVLAIISILILLFVPNLIKEKAQVQKTGEAAVVKVVESQAQLYELDHDNDK
PNLSELLSAGMITQKQVTAYDDYYDQNKNEQRNFDD

Nucleotide

• Length: 351 bp

>NTDB_id=47711 LLH_RS11760 WP_050574401.1 2258479..2258829(-) (comGC) [Lactococcus cremoris subsp. cremoris A76]
ATGAGCAAAGCTTTGTCATTAATTAAAATTCACGGAAGAAAGCTTTGGCAAAAAAAGCAAAAAGCATTTACCTTGATTGA
GATGTTAATTGTGTTGGCAATTATCAGTATTTTAATTTTGCTTTTTGTGCCAAATTTGATAAAAGAAAAAGCACAAGTTC
AAAAAACTGGTGAAGCAGCAGTAGTTAAAGTAGTTGAAAGTCAGGCACAACTTTATGAGTTGGATCATGATAATGATAAG
CCAAACCTATCAGAACTTTTAAGTGCGGGGATGATTACGCAAAAGCAAGTCACGGCCTATGATGATTACTATGACCAGAA
TAAAAATGAACAGCGCAATTTCGATGATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (18-41)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Lactococcus lactis subsp. cremoris KW2	98.276	100	0.983
comYC	Streptococcus gordonii str. Challis substr. CH1	58.586	85.345	0.5
comGC/cglC	Streptococcus mitis SK321	55.882	87.931	0.491
comGC/cglC	Streptococcus pneumoniae R6	53.922	87.931	0.474
comGC/cglC	Streptococcus pneumoniae TIGR4	53.922	87.931	0.474
comGC/cglC	Streptococcus pneumoniae Rx1	53.922	87.931	0.474
comGC/cglC	Streptococcus pneumoniae D39	53.922	87.931	0.474
comYC	Streptococcus mutans UA140	59.14	80.172	0.474
comYC	Streptococcus mutans UA159	59.14	80.172	0.474
comGC/cglC	Streptococcus mitis NCTC 12261	55.67	83.621	0.466
comYC	Streptococcus suis isolate S10	56.818	75.862	0.431