Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGA   Type   Machinery gene
Locus tag   LLH_RS11780 Genome accession   NC_017492
Coordinates   2261595..2261786 (-) Length   63 a.a.
NCBI ID   WP_014573341.1    Uniprot ID   A0A896TDC6
Organism   Lactococcus cremoris subsp. cremoris A76     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2256595..2266786
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LLH_RS11740 (llh_12295) comGG 2257089..2257388 (-) 300 WP_011677181.1 competence type IV pilus minor pilin ComGG Machinery gene
  LLH_RS11745 comGF 2257412..2257837 (-) 426 WP_014735174.1 competence type IV pilus minor pilin ComGF Machinery gene
  LLH_RS11750 (llh_12305) comGE 2257821..2258057 (-) 237 WP_014573335.1 competence type IV pilus minor pilin ComGE Machinery gene
  LLH_RS14595 (llh_12310) comGD 2258089..2258277 (-) 189 WP_014573336.1 hypothetical protein Machinery gene
  LLH_RS11760 (llh_12320) comGC 2258479..2258829 (-) 351 WP_050574401.1 competence type IV pilus major pilin ComGC Machinery gene
  LLH_RS11765 (llh_12325) comGB 2258874..2259899 (-) 1026 WP_050574400.1 competence type IV pilus assembly protein ComGB Machinery gene
  LLH_RS11770 (llh_12330) - 2259799..2260620 (-) 822 Protein_2274 ATPase, T2SS/T4P/T4SS family -
  LLH_RS11775 (llh_12335) - 2260723..2261613 (+) 891 WP_014573340.1 IS982-like element IS982B family transposase -
  LLH_RS11780 (llh_12340) comGA 2261595..2261786 (-) 192 WP_014573341.1 hypothetical protein Machinery gene
  LLH_RS11785 (llh_12345) - 2261901..2265731 (-) 3831 Protein_2277 PolC-type DNA polymerase III -

Sequence


Protein


Download         Length: 63 a.a.        Molecular weight: 7255.51 Da        Isoelectric Point: 4.3901

>NTDB_id=47713 LLH_RS11780 WP_014573341.1 2261595..2261786(-) (comGA) [Lactococcus cremoris subsp. cremoris A76]
MVQKKAQELIQKAIEMEASDIYLIASGNLYKIYIRQQLGRTLIEELNQEIGLPELLVDYLAMT

Nucleotide


Download         Length: 192 bp        

>NTDB_id=47713 LLH_RS11780 WP_014573341.1 2261595..2261786(-) (comGA) [Lactococcus cremoris subsp. cremoris A76]
ATGGTACAGAAAAAAGCACAAGAACTCATTCAAAAGGCAATTGAGATGGAGGCTTCTGATATTTATTTAATTGCTTCAGG
AAATCTTTATAAGATATATATTCGTCAACAATTAGGGCGAACTTTAATAGAGGAACTTAACCAAGAGATTGGTTTACCCG
AATTGCTAGTTGATTATTTAGCCATGACTTGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGA Lactococcus lactis subsp. cremoris KW2

96.226

84.127

0.81


Multiple sequence alignment