Detailed information
Overview
| Name | comGA | Type | Machinery gene |
| Locus tag | LLH_RS11780 | Genome accession | NC_017492 |
| Coordinates | 2261595..2261786 (-) | Length | 63 a.a. |
| NCBI ID | WP_014573341.1 | Uniprot ID | A0A896TDC6 |
| Organism | Lactococcus cremoris subsp. cremoris A76 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 2252555..2260656 | 2261595..2261786 | flank | 939 |
| IS/Tn | 2260723..2261613 | 2261595..2261786 | flank | -18 |
Gene organization within MGE regions
Location: 2252555..2261786
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLH_RS11720 (llh_12275) | - | 2254015..2254824 (-) | 810 | WP_011677177.1 | metal ABC transporter permease | - |
| LLH_RS11725 (llh_12280) | - | 2254817..2255554 (-) | 738 | WP_011677178.1 | metal ABC transporter ATP-binding protein | - |
| LLH_RS11730 (llh_12285) | - | 2255733..2256575 (-) | 843 | WP_011677179.1 | metal ABC transporter solute-binding protein, Zn/Mn family | - |
| LLH_RS11735 (llh_12290) | - | 2256572..2257009 (-) | 438 | WP_011677180.1 | zinc-dependent MarR family transcriptional regulator | - |
| LLH_RS11740 (llh_12295) | comGG | 2257089..2257388 (-) | 300 | WP_011677181.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| LLH_RS11745 | comGF | 2257412..2257837 (-) | 426 | WP_014735174.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| LLH_RS11750 (llh_12305) | comGE | 2257821..2258057 (-) | 237 | WP_014573335.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| LLH_RS14595 (llh_12310) | comGD | 2258089..2258277 (-) | 189 | WP_014573336.1 | hypothetical protein | Machinery gene |
| LLH_RS11760 (llh_12320) | comGC | 2258479..2258829 (-) | 351 | WP_050574401.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| LLH_RS11765 (llh_12325) | comGB | 2258874..2259899 (-) | 1026 | WP_050574400.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| LLH_RS11770 (llh_12330) | - | 2259799..2260620 (-) | 822 | Protein_2274 | ATPase, T2SS/T4P/T4SS family | - |
| LLH_RS11775 (llh_12335) | - | 2260723..2261613 (+) | 891 | WP_014573340.1 | IS982-like element IS982B family transposase | - |
| LLH_RS11780 (llh_12340) | comGA | 2261595..2261786 (-) | 192 | WP_014573341.1 | hypothetical protein | Machinery gene |
Sequence
Protein
Download Length: 63 a.a. Molecular weight: 7255.51 Da Isoelectric Point: 4.3901
>NTDB_id=47713 LLH_RS11780 WP_014573341.1 2261595..2261786(-) (comGA) [Lactococcus cremoris subsp. cremoris A76]
MVQKKAQELIQKAIEMEASDIYLIASGNLYKIYIRQQLGRTLIEELNQEIGLPELLVDYLAMT
MVQKKAQELIQKAIEMEASDIYLIASGNLYKIYIRQQLGRTLIEELNQEIGLPELLVDYLAMT
Nucleotide
Download Length: 192 bp
>NTDB_id=47713 LLH_RS11780 WP_014573341.1 2261595..2261786(-) (comGA) [Lactococcus cremoris subsp. cremoris A76]
ATGGTACAGAAAAAAGCACAAGAACTCATTCAAAAGGCAATTGAGATGGAGGCTTCTGATATTTATTTAATTGCTTCAGG
AAATCTTTATAAGATATATATTCGTCAACAATTAGGGCGAACTTTAATAGAGGAACTTAACCAAGAGATTGGTTTACCCG
AATTGCTAGTTGATTATTTAGCCATGACTTGA
ATGGTACAGAAAAAAGCACAAGAACTCATTCAAAAGGCAATTGAGATGGAGGCTTCTGATATTTATTTAATTGCTTCAGG
AAATCTTTATAAGATATATATTCGTCAACAATTAGGGCGAACTTTAATAGAGGAACTTAACCAAGAGATTGGTTTACCCG
AATTGCTAGTTGATTATTTAGCCATGACTTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGA | Lactococcus lactis subsp. cremoris KW2 |
96.226 |
84.127 |
0.81 |