Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | H7797_RS04285 | Genome accession | NZ_CP060639 |
| Coordinates | 841869..842057 (+) | Length | 62 a.a. |
| NCBI ID | WP_011528571.1 | Uniprot ID | A0A660A3N3 |
| Organism | Streptococcus pyogenes strain TSPY153 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 802490..850449 | 841869..842057 | within | 0 |
Gene organization within MGE regions
Location: 802490..850449
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7797_RS04010 (H7797_03985) | - | 802490..803083 (+) | 594 | WP_111693149.1 | dTDP-4-dehydrorhamnose 3,5-epimerase family protein | - |
| H7797_RS04015 (H7797_03990) | rfbB | 803327..804367 (+) | 1041 | WP_111693150.1 | dTDP-glucose 4,6-dehydratase | - |
| H7797_RS04020 (H7797_03995) | - | 804450..805589 (-) | 1140 | WP_011528538.1 | tyrosine-type recombinase/integrase | - |
| H7797_RS04025 (H7797_04000) | - | 805711..806397 (-) | 687 | WP_011528539.1 | hypothetical protein | - |
| H7797_RS09825 | - | 806427..806561 (-) | 135 | WP_011106663.1 | hypothetical protein | - |
| H7797_RS04030 (H7797_04005) | - | 806568..806720 (-) | 153 | WP_011054825.1 | hypothetical protein | - |
| H7797_RS04035 (H7797_04010) | - | 806731..807108 (-) | 378 | WP_011054824.1 | ImmA/IrrE family metallo-endopeptidase | - |
| H7797_RS04040 (H7797_04015) | - | 807092..807451 (-) | 360 | WP_011528540.1 | helix-turn-helix domain-containing protein | - |
| H7797_RS04045 (H7797_04020) | - | 807640..807858 (+) | 219 | WP_009881062.1 | helix-turn-helix domain-containing protein | - |
| H7797_RS04050 (H7797_04025) | - | 807953..808204 (+) | 252 | WP_011528542.1 | helix-turn-helix transcriptional regulator | - |
| H7797_RS09830 | - | 808235..808369 (+) | 135 | WP_011528543.1 | hypothetical protein | - |
| H7797_RS04055 (H7797_04030) | - | 808385..808699 (+) | 315 | WP_011528544.1 | helix-turn-helix transcriptional regulator | - |
| H7797_RS04060 (H7797_04035) | - | 808926..809408 (+) | 483 | WP_011528545.1 | siphovirus Gp157 family protein | - |
| H7797_RS04065 (H7797_04040) | - | 809409..810089 (+) | 681 | WP_002995975.1 | AAA family ATPase | - |
| H7797_RS04070 (H7797_04045) | - | 810191..811420 (+) | 1230 | WP_011528546.1 | DEAD/DEAH box helicase | - |
| H7797_RS04075 (H7797_04050) | - | 811436..811894 (+) | 459 | WP_002995969.1 | DUF669 domain-containing protein | - |
| H7797_RS04080 (H7797_04055) | - | 811897..812709 (+) | 813 | WP_030126642.1 | bifunctional DNA primase/polymerase | - |
| H7797_RS04085 (H7797_04060) | - | 812699..814181 (+) | 1483 | Protein_768 | phage/plasmid primase, P4 family | - |
| H7797_RS04095 (H7797_04065) | - | 814426..814747 (+) | 322 | Protein_769 | VRR-NUC domain-containing protein | - |
| H7797_RS04100 (H7797_04070) | - | 814731..815087 (+) | 357 | WP_011018138.1 | hypothetical protein | - |
| H7797_RS09885 | - | 815084..815335 (+) | 252 | WP_011528549.1 | hypothetical protein | - |
| H7797_RS04105 (H7797_04075) | - | 815329..815613 (+) | 285 | WP_020905119.1 | DUF3310 domain-containing protein | - |
| H7797_RS04110 (H7797_04080) | - | 815610..815879 (+) | 270 | WP_011054754.1 | hypothetical protein | - |
| H7797_RS04115 (H7797_04085) | - | 815889..816293 (+) | 405 | WP_228636960.1 | YopX family protein | - |
| H7797_RS04120 (H7797_04090) | - | 816290..816460 (+) | 171 | WP_011054752.1 | hypothetical protein | - |
| H7797_RS04125 (H7797_04095) | - | 816457..816963 (+) | 507 | WP_011054751.1 | DUF1642 domain-containing protein | - |
| H7797_RS04130 (H7797_04100) | - | 816960..817130 (+) | 171 | WP_164997036.1 | hypothetical protein | - |
| H7797_RS04135 (H7797_04105) | - | 817404..817844 (+) | 441 | WP_011017866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| H7797_RS04140 (H7797_04110) | - | 818208..818426 (-) | 219 | WP_011528550.1 | hypothetical protein | - |
| H7797_RS04145 (H7797_04115) | - | 818513..818893 (+) | 381 | WP_011285571.1 | hypothetical protein | - |
| H7797_RS04150 (H7797_04120) | - | 818883..820157 (+) | 1275 | WP_021299302.1 | PBSX family phage terminase large subunit | - |
| H7797_RS04155 (H7797_04125) | - | 820157..821482 (+) | 1326 | WP_011528552.1 | phage portal protein | - |
| H7797_RS04160 (H7797_04130) | - | 821451..822359 (+) | 909 | WP_011528553.1 | minor capsid protein | - |
| H7797_RS04165 (H7797_04135) | - | 822366..822596 (+) | 231 | WP_011528554.1 | hypothetical protein | - |
| H7797_RS04170 (H7797_04140) | - | 822708..823277 (+) | 570 | WP_021299309.1 | DUF4355 domain-containing protein | - |
| H7797_RS04175 (H7797_04145) | - | 823296..824186 (+) | 891 | WP_009880261.1 | hypothetical protein | - |
| H7797_RS04180 (H7797_04150) | - | 824198..824491 (+) | 294 | WP_011528557.1 | HeH/LEM domain-containing protein | - |
| H7797_RS04185 (H7797_04155) | - | 824505..824849 (+) | 345 | WP_011528558.1 | hypothetical protein | - |
| H7797_RS04190 (H7797_04160) | - | 824846..825157 (+) | 312 | WP_011528559.1 | hypothetical protein | - |
| H7797_RS04195 (H7797_04165) | - | 825154..825549 (+) | 396 | WP_011528560.1 | hypothetical protein | - |
| H7797_RS04200 (H7797_04170) | - | 825551..825961 (+) | 411 | WP_011528561.1 | DUF5072 family protein | - |
| H7797_RS04205 (H7797_04175) | - | 825973..826479 (+) | 507 | WP_079890482.1 | phage major tail protein, TP901-1 family | - |
| H7797_RS04210 (H7797_04180) | - | 826492..826809 (+) | 318 | WP_011528563.1 | hypothetical protein | - |
| H7797_RS04215 (H7797_04185) | - | 826941..827240 (+) | 300 | WP_228637123.1 | hypothetical protein | - |
| H7797_RS04220 (H7797_04190) | - | 827233..829038 (+) | 1806 | WP_011528565.1 | tail protein | - |
| H7797_RS04225 (H7797_04195) | - | 829039..830523 (+) | 1485 | WP_011528566.1 | distal tail protein Dit | - |
| H7797_RS04230 (H7797_04200) | - | 830524..833973 (+) | 3450 | WP_228637125.1 | glucosaminidase domain-containing protein | - |
| H7797_RS04235 (H7797_04205) | - | 833978..835840 (+) | 1863 | WP_011528568.1 | DUF859 family phage minor structural protein | - |
| H7797_RS04240 (H7797_04210) | - | 835851..836198 (+) | 348 | WP_009880247.1 | DUF1366 domain-containing protein | - |
| H7797_RS09835 | - | 836212..836334 (+) | 123 | WP_015055953.1 | hypothetical protein | - |
| H7797_RS04245 (H7797_04215) | - | 836670..837002 (+) | 333 | WP_011054798.1 | phage holin | - |
| H7797_RS04250 (H7797_04220) | - | 837004..837768 (+) | 765 | WP_011054797.1 | CHAP domain-containing protein | - |
| H7797_RS04255 (H7797_04225) | - | 837780..838382 (+) | 603 | WP_011054796.1 | hypothetical protein | - |
| H7797_RS04260 (H7797_04230) | - | 838393..839166 (+) | 774 | WP_011528569.1 | hypothetical protein | - |
| H7797_RS04265 (H7797_04235) | - | 839176..839397 (+) | 222 | WP_009880241.1 | hypothetical protein | - |
| H7797_RS04270 (H7797_04240) | - | 839397..840056 (+) | 660 | WP_011528570.1 | hypothetical protein | - |
| H7797_RS04275 (H7797_04245) | - | 840125..840559 (-) | 435 | WP_011017966.1 | hypothetical protein | - |
| H7797_RS04280 (H7797_04250) | sda3 | 840831..841631 (-) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| H7797_RS04285 (H7797_04255) | prx | 841869..842057 (+) | 189 | WP_011528571.1 | hypothetical protein | Regulator |
| H7797_RS04290 (H7797_04260) | - | 842465..842941 (+) | 477 | WP_002984880.1 | NUDIX hydrolase | - |
| H7797_RS04295 (H7797_04265) | - | 842999..844180 (+) | 1182 | WP_002984879.1 | AI-2E family transporter | - |
| H7797_RS04300 (H7797_04270) | - | 844170..845417 (+) | 1248 | WP_111693151.1 | tetratricopeptide repeat protein | - |
| H7797_RS04305 (H7797_04275) | fbp54 | 845476..847128 (-) | 1653 | WP_111693152.1 | Rqc2 family fibronectin-binding protein Fbp54 | - |
| H7797_RS04310 (H7797_04280) | trpX | 847482..848480 (+) | 999 | WP_111693153.1 | tryptophan ABC transporter substrate-binding protein | - |
| H7797_RS04315 (H7797_04290) | - | 848825..849694 (+) | 870 | WP_002991975.1 | ABC transporter permease | - |
| H7797_RS04320 (H7797_04295) | - | 849691..850449 (+) | 759 | WP_002989991.1 | ABC transporter ATP-binding protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7224.11 Da Isoelectric Point: 4.0606
>NTDB_id=476988 H7797_RS04285 WP_011528571.1 841869..842057(+) (prx) [Streptococcus pyogenes strain TSPY153]
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
Nucleotide
Download Length: 189 bp
>NTDB_id=476988 H7797_RS04285 WP_011528571.1 841869..842057(+) (prx) [Streptococcus pyogenes strain TSPY153]
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
96.774 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
96.774 |
0.694 |
| prx | Streptococcus pyogenes MGAS315 |
90.698 |
69.355 |
0.629 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
66.129 |
0.565 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |