Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | H7798_RS06280 | Genome accession | NZ_CP060638 |
| Coordinates | 1275582..1275764 (-) | Length | 60 a.a. |
| NCBI ID | WP_003056293.1 | Uniprot ID | A0A5S4TFM2 |
| Organism | Streptococcus pyogenes strain TSPY141 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1275582..1316406 | 1275582..1275764 | within | 0 |
Gene organization within MGE regions
Location: 1275582..1316406
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7798_RS06280 (H7798_06310) | prx | 1275582..1275764 (-) | 183 | WP_003056293.1 | hypothetical protein | Regulator |
| H7798_RS06285 (H7798_06315) | - | 1276003..1276803 (+) | 801 | WP_021340119.1 | DNA/RNA non-specific endonuclease | - |
| H7798_RS06290 (H7798_06320) | - | 1277425..1278630 (-) | 1206 | WP_085613963.1 | glucosaminidase domain-containing protein | - |
| H7798_RS06295 (H7798_06325) | - | 1278746..1278973 (-) | 228 | WP_003058873.1 | phage holin | - |
| H7798_RS06300 (H7798_06330) | - | 1278970..1279242 (-) | 273 | WP_085613962.1 | hypothetical protein | - |
| H7798_RS06305 (H7798_06335) | - | 1279252..1279869 (-) | 618 | WP_085613961.1 | DUF1366 domain-containing protein | - |
| H7798_RS06310 (H7798_06340) | - | 1279872..1280303 (-) | 432 | WP_228653621.1 | DUF1617 family protein | - |
| H7798_RS06315 (H7798_06345) | - | 1280315..1282201 (-) | 1887 | WP_129820704.1 | gp58-like family protein | - |
| H7798_RS06320 (H7798_06350) | - | 1282212..1282526 (-) | 315 | WP_021340983.1 | hypothetical protein | - |
| H7798_RS06325 (H7798_06355) | - | 1282528..1283742 (-) | 1215 | WP_011284843.1 | hypothetical protein | - |
| H7798_RS06330 (H7798_06360) | - | 1283739..1285886 (-) | 2148 | WP_174142696.1 | phage tail spike protein | - |
| H7798_RS06335 (H7798_06365) | - | 1285883..1286599 (-) | 717 | WP_010922089.1 | distal tail protein Dit | - |
| H7798_RS06340 (H7798_06370) | - | 1286596..1289856 (-) | 3261 | WP_228653623.1 | tape measure protein | - |
| H7798_RS06345 (H7798_06375) | - | 1289846..1290427 (-) | 582 | WP_010922087.1 | bacteriophage Gp15 family protein | - |
| H7798_RS06350 (H7798_06380) | - | 1290431..1290865 (-) | 435 | WP_010922086.1 | hypothetical protein | - |
| H7798_RS06355 (H7798_06385) | - | 1290918..1291388 (-) | 471 | WP_011527917.1 | phage tail tube protein | - |
| H7798_RS06360 (H7798_06390) | - | 1291388..1291786 (-) | 399 | WP_010922084.1 | minor capsid protein | - |
| H7798_RS06365 (H7798_06395) | - | 1291783..1292139 (-) | 357 | WP_010922083.1 | minor capsid protein | - |
| H7798_RS06370 (H7798_06400) | - | 1292139..1292471 (-) | 333 | WP_010922082.1 | minor capsid protein | - |
| H7798_RS06375 (H7798_06405) | - | 1292461..1292877 (-) | 417 | WP_010922081.1 | hypothetical protein | - |
| H7798_RS06380 (H7798_06410) | - | 1292931..1293749 (-) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| H7798_RS06385 (H7798_06415) | - | 1293753..1294367 (-) | 615 | WP_085613955.1 | hypothetical protein | - |
| H7798_RS06390 (H7798_06420) | - | 1294493..1294759 (-) | 267 | WP_085613954.1 | hypothetical protein | - |
| H7798_RS06395 (H7798_06425) | - | 1294821..1295060 (-) | 240 | WP_002986829.1 | hypothetical protein | - |
| H7798_RS06400 (H7798_06430) | - | 1295032..1296510 (-) | 1479 | WP_032463353.1 | phage minor capsid protein | - |
| H7798_RS06405 (H7798_06435) | - | 1296515..1298017 (-) | 1503 | WP_010922075.1 | phage portal protein | - |
| H7798_RS06410 (H7798_06440) | - | 1298031..1299322 (-) | 1292 | Protein_1246 | PBSX family phage terminase large subunit | - |
| H7798_RS06415 (H7798_06445) | - | 1299325..1299798 (-) | 474 | WP_023612332.1 | hypothetical protein | - |
| H7798_RS06420 (H7798_06450) | - | 1299849..1300226 (-) | 378 | WP_002986841.1 | ASCH domain-containing protein | - |
| H7798_RS06425 (H7798_06455) | - | 1300287..1300763 (-) | 477 | WP_174132581.1 | GNAT family N-acetyltransferase | - |
| H7798_RS06430 (H7798_06460) | - | 1300679..1301356 (-) | 678 | WP_002986850.1 | ABC transporter ATP-binding protein | - |
| H7798_RS06435 (H7798_06465) | - | 1301335..1301853 (-) | 519 | WP_002986854.1 | ParB N-terminal domain-containing protein | - |
| H7798_RS06440 (H7798_06470) | - | 1301934..1302191 (+) | 258 | WP_011054748.1 | hypothetical protein | - |
| H7798_RS06445 (H7798_06475) | - | 1302766..1303203 (-) | 438 | WP_021340586.1 | DUF1492 domain-containing protein | - |
| H7798_RS06450 (H7798_06480) | - | 1303568..1303861 (-) | 294 | WP_032460172.1 | hypothetical protein | - |
| H7798_RS06455 (H7798_06485) | - | 1303909..1304673 (-) | 765 | WP_032463361.1 | DNA-methyltransferase | - |
| H7798_RS06460 (H7798_06490) | - | 1304663..1304749 (-) | 87 | Protein_1256 | SAM-dependent methyltransferase | - |
| H7798_RS06465 (H7798_06495) | - | 1304912..1305181 (-) | 270 | WP_032463364.1 | hypothetical protein | - |
| H7798_RS06470 | - | 1305186..1305371 (-) | 186 | WP_011017985.1 | hypothetical protein | - |
| H7798_RS06475 (H7798_06500) | - | 1305358..1305870 (-) | 513 | WP_032463367.1 | phage protein | - |
| H7798_RS06480 (H7798_06505) | - | 1305867..1306205 (-) | 339 | WP_002990067.1 | hypothetical protein | - |
| H7798_RS06485 (H7798_06510) | - | 1306382..1306549 (-) | 168 | WP_009880273.1 | hypothetical protein | - |
| H7798_RS06490 (H7798_06515) | - | 1306559..1307356 (-) | 798 | WP_085613952.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| H7798_RS06495 (H7798_06520) | - | 1307349..1307549 (-) | 201 | WP_000594115.1 | hypothetical protein | - |
| H7798_RS06500 (H7798_06525) | - | 1307546..1308472 (-) | 927 | WP_011054700.1 | recombinase RecT | - |
| H7798_RS06505 (H7798_06530) | - | 1308475..1308804 (-) | 330 | WP_011528796.1 | hypothetical protein | - |
| H7798_RS06510 (H7798_06535) | - | 1308860..1309066 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| H7798_RS06515 (H7798_06545) | - | 1309221..1309433 (-) | 213 | WP_002986875.1 | hypothetical protein | - |
| H7798_RS06520 (H7798_06550) | - | 1309414..1309824 (-) | 411 | WP_172450154.1 | DnaD domain-containing protein | - |
| H7798_RS06525 (H7798_06555) | - | 1309946..1310203 (-) | 258 | WP_019418742.1 | hypothetical protein | - |
| H7798_RS06530 (H7798_06560) | - | 1310297..1310482 (-) | 186 | WP_002986881.1 | hypothetical protein | - |
| H7798_RS06535 (H7798_06565) | - | 1310511..1310768 (-) | 258 | WP_032463372.1 | hypothetical protein | - |
| H7798_RS06540 (H7798_06570) | - | 1310874..1311089 (+) | 216 | WP_023611028.1 | hypothetical protein | - |
| H7798_RS06545 (H7798_06575) | - | 1311063..1311311 (-) | 249 | WP_023611035.1 | hypothetical protein | - |
| H7798_RS06550 (H7798_06580) | - | 1311390..1311590 (+) | 201 | WP_002986887.1 | KTSC domain-containing protein | - |
| H7798_RS06555 (H7798_06585) | - | 1311587..1311736 (-) | 150 | WP_002986888.1 | hypothetical protein | - |
| H7798_RS06560 (H7798_06590) | - | 1311769..1312497 (-) | 729 | WP_002986890.1 | phage antirepressor KilAC domain-containing protein | - |
| H7798_RS06565 (H7798_06595) | - | 1312508..1312699 (-) | 192 | WP_002986891.1 | hypothetical protein | - |
| H7798_RS06570 (H7798_06600) | - | 1313334..1313429 (+) | 96 | WP_020837683.1 | type I toxin-antitoxin system Fst family toxin | - |
| H7798_RS06575 (H7798_06605) | - | 1313848..1314207 (+) | 360 | WP_011054768.1 | helix-turn-helix domain-containing protein | - |
| H7798_RS06580 (H7798_06610) | - | 1314221..1314601 (+) | 381 | WP_002986894.1 | ImmA/IrrE family metallo-endopeptidase | - |
| H7798_RS06585 (H7798_06615) | - | 1314612..1315133 (+) | 522 | WP_002986895.1 | hypothetical protein | - |
| H7798_RS06590 (H7798_06620) | - | 1315309..1316406 (+) | 1098 | WP_032463383.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6877.91 Da Isoelectric Point: 4.2840
>NTDB_id=476943 H7798_RS06280 WP_003056293.1 1275582..1275764(-) (prx) [Streptococcus pyogenes strain TSPY141]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPGEPVKPWEILTEVIVEAVLRELDK
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPGEPVKPWEILTEVIVEAVLRELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=476943 H7798_RS06280 WP_003056293.1 1275582..1275764(-) (prx) [Streptococcus pyogenes strain TSPY141]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCTGGTGAGCCTGTGAAACCGTGGGAAATTTTGACTGAAGTAATAGTAGAAGCAG
TGCTGAGGGAATTAGACAAATAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCTGGTGAGCCTGTGAAACCGTGGGAAATTTTGACTGAAGTAATAGTAGAAGCAG
TGCTGAGGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS8232 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
68.333 |
0.567 |
| prx | Streptococcus pyogenes MGAS315 |
78.049 |
68.333 |
0.533 |