Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | H7798_RS05725 | Genome accession | NZ_CP060638 |
| Coordinates | 1182741..1182923 (-) | Length | 60 a.a. |
| NCBI ID | WP_011184726.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain TSPY141 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1182741..1217544 | 1182741..1182923 | within | 0 |
Gene organization within MGE regions
Location: 1182741..1217544
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7798_RS05725 (H7798_05760) | prx | 1182741..1182923 (-) | 183 | WP_011184726.1 | hypothetical protein | Regulator |
| H7798_RS05730 (H7798_05765) | mf2 | 1183163..1183921 (+) | 759 | WP_011184727.1 | DNase Mf2 | - |
| H7798_RS05735 (H7798_05770) | speC | 1184032..1184739 (+) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| H7798_RS05740 (H7798_05775) | - | 1184808..1185560 (-) | 753 | WP_030126404.1 | CHAP domain-containing protein | - |
| H7798_RS05745 (H7798_05780) | - | 1185678..1186133 (-) | 456 | WP_011184730.1 | phage holin family protein | - |
| H7798_RS05750 (H7798_05785) | - | 1186143..1186754 (-) | 612 | WP_011184731.1 | DUF1366 domain-containing protein | - |
| H7798_RS05755 (H7798_05790) | - | 1186757..1187185 (-) | 429 | WP_011184732.1 | DUF1617 family protein | - |
| H7798_RS05760 (H7798_05795) | - | 1187194..1188975 (-) | 1782 | WP_011184733.1 | gp58-like family protein | - |
| H7798_RS05765 (H7798_05800) | - | 1188990..1190099 (-) | 1110 | WP_011184734.1 | hyaluronoglucosaminidase | - |
| H7798_RS05770 (H7798_05805) | - | 1190099..1192072 (-) | 1974 | WP_011054676.1 | phage tail spike protein | - |
| H7798_RS05775 (H7798_05810) | - | 1192054..1192749 (-) | 696 | WP_002992579.1 | hypothetical protein | - |
| H7798_RS05780 (H7798_05815) | - | 1192746..1195109 (-) | 2364 | WP_030126402.1 | hypothetical protein | - |
| H7798_RS05785 (H7798_05820) | - | 1195109..1195480 (-) | 372 | WP_011054678.1 | DUF5361 domain-containing protein | - |
| H7798_RS05790 (H7798_05825) | - | 1195495..1195758 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| H7798_RS05795 (H7798_05830) | - | 1195769..1196359 (-) | 591 | WP_011054679.1 | hypothetical protein | - |
| H7798_RS05800 (H7798_05835) | - | 1196375..1196710 (-) | 336 | WP_000573598.1 | hypothetical protein | - |
| H7798_RS05805 (H7798_05840) | - | 1196711..1196947 (-) | 237 | WP_000032787.1 | hypothetical protein | - |
| H7798_RS05810 (H7798_05845) | - | 1196940..1197278 (-) | 339 | WP_011054681.1 | hypothetical protein | - |
| H7798_RS05815 (H7798_05850) | - | 1197238..1197660 (-) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| H7798_RS05820 (H7798_05855) | - | 1197670..1197870 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| H7798_RS05825 (H7798_05860) | - | 1197870..1198781 (-) | 912 | WP_011054683.1 | phage major capsid protein | - |
| H7798_RS05830 (H7798_05865) | - | 1198806..1199267 (-) | 462 | WP_010922462.1 | DUF4355 domain-containing protein | - |
| H7798_RS05835 (H7798_05870) | - | 1199348..1200763 (-) | 1416 | WP_011054685.1 | terminase | - |
| H7798_RS05840 (H7798_05875) | - | 1200845..1201060 (-) | 216 | WP_011106704.1 | hypothetical protein | - |
| H7798_RS05845 (H7798_05880) | - | 1201062..1201328 (-) | 267 | WP_002986828.1 | hypothetical protein | - |
| H7798_RS05850 (H7798_05885) | - | 1201321..1201473 (-) | 153 | WP_011054687.1 | hypothetical protein | - |
| H7798_RS05855 (H7798_05890) | - | 1201550..1201774 (-) | 225 | WP_002994100.1 | hypothetical protein | - |
| H7798_RS05860 (H7798_05895) | - | 1201780..1203273 (-) | 1494 | WP_010922467.1 | hypothetical protein | - |
| H7798_RS05865 (H7798_05900) | - | 1203266..1204534 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| H7798_RS05870 (H7798_05905) | - | 1204531..1204887 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| H7798_RS05875 (H7798_05910) | - | 1205035..1205379 (-) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| H7798_RS05880 (H7798_05915) | - | 1205487..1205906 (-) | 420 | WP_030126399.1 | DUF1492 domain-containing protein | - |
| H7798_RS05885 (H7798_05920) | - | 1205982..1206233 (-) | 252 | WP_011054692.1 | hypothetical protein | - |
| H7798_RS05890 (H7798_05925) | - | 1206230..1206385 (-) | 156 | WP_011054693.1 | hypothetical protein | - |
| H7798_RS05895 (H7798_05930) | - | 1206382..1206699 (-) | 318 | WP_011054694.1 | DUF1372 family protein | - |
| H7798_RS05900 (H7798_05935) | - | 1206735..1207247 (-) | 513 | WP_011054695.1 | hypothetical protein | - |
| H7798_RS05905 (H7798_05940) | - | 1207244..1207576 (-) | 333 | WP_011184741.1 | hypothetical protein | - |
| H7798_RS05910 (H7798_05945) | - | 1207587..1208933 (-) | 1347 | WP_011054697.1 | PcfJ domain-containing protein | - |
| H7798_RS05915 (H7798_05950) | - | 1208930..1209325 (-) | 396 | WP_011054698.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| H7798_RS05920 (H7798_05955) | - | 1209690..1210487 (-) | 798 | WP_011054699.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| H7798_RS05925 (H7798_05960) | - | 1210480..1210680 (-) | 201 | WP_000594115.1 | hypothetical protein | - |
| H7798_RS05930 (H7798_05965) | - | 1210677..1211603 (-) | 927 | WP_011054700.1 | recombinase RecT | - |
| H7798_RS05935 (H7798_05970) | - | 1211606..1211935 (-) | 330 | WP_010922207.1 | hypothetical protein | - |
| H7798_RS05940 (H7798_05975) | - | 1211991..1212197 (-) | 207 | WP_002990074.1 | hypothetical protein | - |
| H7798_RS05945 (H7798_05980) | - | 1212206..1212346 (-) | 141 | WP_002988354.1 | hypothetical protein | - |
| H7798_RS05950 (H7798_05985) | - | 1212343..1212576 (-) | 234 | WP_002988350.1 | hypothetical protein | - |
| H7798_RS05955 (H7798_05990) | - | 1212557..1212943 (-) | 387 | WP_002990076.1 | DnaD domain-containing protein | - |
| H7798_RS05960 | - | 1213084..1213353 (-) | 270 | WP_011106700.1 | replication protein | - |
| H7798_RS05965 (H7798_05995) | - | 1213447..1213632 (-) | 186 | WP_010922477.1 | hypothetical protein | - |
| H7798_RS05970 (H7798_06000) | - | 1213634..1213945 (-) | 312 | WP_010922478.1 | excisionase | - |
| H7798_RS05975 (H7798_06005) | - | 1214215..1214427 (-) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| H7798_RS05980 (H7798_06010) | - | 1214629..1215384 (+) | 756 | WP_010922480.1 | helix-turn-helix domain-containing protein | - |
| H7798_RS05985 (H7798_06015) | - | 1215396..1215914 (+) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| H7798_RS05990 (H7798_06020) | - | 1216038..1217180 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| H7798_RS05995 (H7798_06025) | - | 1217269..1217544 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6936.91 Da Isoelectric Point: 4.1954
>NTDB_id=476940 H7798_RS05725 WP_011184726.1 1182741..1182923(-) (prx) [Streptococcus pyogenes strain TSPY141]
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=476940 H7798_RS05725 WP_011184726.1 1182741..1182923(-) (prx) [Streptococcus pyogenes strain TSPY141]
ATGCTAACATACGACGAATTTAAACAAGCAATTGACAATGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAACAAGCAATTGACAATGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS8232 |
86.667 |
100 |
0.867 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
68.333 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
70 |
0.5 |