Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | H7684_RS11945 | Genome accession | NZ_CP060278 |
| Coordinates | 2435716..2436186 (-) | Length | 156 a.a. |
| NCBI ID | WP_000934764.1 | Uniprot ID | A0A9P4DKA4 |
| Organism | Staphylococcus aureus strain KZN | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2405370..2457201 | 2435716..2436186 | within | 0 |
Gene organization within MGE regions
Location: 2405370..2457201
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7684_RS11725 (H7684_11725) | scn | 2405370..2405720 (-) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| H7684_RS11730 (H7684_11730) | - | 2406406..2406855 (+) | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| H7684_RS11735 (H7684_11735) | - | 2406950..2407285 (-) | 336 | Protein_2289 | SH3 domain-containing protein | - |
| H7684_RS11740 (H7684_11740) | sak | 2407935..2408426 (-) | 492 | WP_000919350.1 | staphylokinase | - |
| H7684_RS11745 (H7684_11745) | - | 2408617..2409372 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| H7684_RS11750 (H7684_11750) | - | 2409384..2409638 (-) | 255 | WP_000611512.1 | phage holin | - |
| H7684_RS11755 (H7684_11755) | - | 2409690..2409797 (+) | 108 | WP_001791821.1 | hypothetical protein | - |
| H7684_RS11760 (H7684_11760) | pepG1 | 2409850..2409984 (-) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| H7684_RS11765 (H7684_11765) | sea | 2410135..2410908 (-) | 774 | WP_000750406.1 | staphylococcal enterotoxin type A | - |
| H7684_RS11770 (H7684_11770) | - | 2411329..2411703 (-) | 375 | WP_000340977.1 | hypothetical protein | - |
| H7684_RS11775 (H7684_11775) | - | 2411759..2412046 (-) | 288 | WP_001040259.1 | hypothetical protein | - |
| H7684_RS11780 (H7684_11780) | - | 2412093..2412245 (-) | 153 | WP_001153681.1 | hypothetical protein | - |
| H7684_RS11785 (H7684_11785) | - | 2412235..2416020 (-) | 3786 | WP_000582190.1 | phage tail spike protein | - |
| H7684_RS11790 (H7684_11790) | - | 2416036..2417520 (-) | 1485 | WP_000567413.1 | phage tail domain-containing protein | - |
| H7684_RS11795 (H7684_11795) | - | 2417517..2422046 (-) | 4530 | Protein_2301 | phage tail tape measure protein | - |
| H7684_RS11800 (H7684_11800) | - | 2422103..2422240 (-) | 138 | WP_001549167.1 | hypothetical protein | - |
| H7684_RS11805 (H7684_11805) | - | 2422291..2422641 (-) | 351 | WP_001096355.1 | hypothetical protein | - |
| H7684_RS11810 (H7684_11810) | - | 2422691..2422915 (-) | 225 | WP_071621395.1 | Ig-like domain-containing protein | - |
| H7684_RS11815 (H7684_11815) | - | 2422957..2423601 (-) | 645 | WP_000268735.1 | major tail protein | - |
| H7684_RS11820 (H7684_11820) | - | 2423602..2424009 (-) | 408 | WP_000565498.1 | hypothetical protein | - |
| H7684_RS11825 (H7684_11825) | - | 2424006..2424410 (-) | 405 | WP_031768935.1 | HK97 gp10 family phage protein | - |
| H7684_RS11830 (H7684_11830) | - | 2424407..2424769 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| H7684_RS11835 (H7684_11835) | - | 2424753..2425037 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| H7684_RS11840 (H7684_11840) | - | 2425027..2425310 (-) | 284 | Protein_2310 | hypothetical protein | - |
| H7684_RS11845 (H7684_11845) | - | 2425330..2426475 (-) | 1146 | WP_000154559.1 | phage major capsid protein | - |
| H7684_RS11850 (H7684_11850) | - | 2426499..2427236 (-) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| H7684_RS11855 (H7684_11855) | - | 2427220..2428407 (-) | 1188 | WP_000025274.1 | phage portal protein | - |
| H7684_RS11860 (H7684_11860) | - | 2428423..2430084 (-) | 1662 | WP_000625088.1 | terminase large subunit | - |
| H7684_RS11865 (H7684_11865) | - | 2430081..2430425 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| H7684_RS11870 (H7684_11870) | - | 2430555..2430854 (-) | 300 | WP_000988336.1 | HNH endonuclease | - |
| H7684_RS11875 (H7684_11875) | - | 2431086..2431502 (-) | 417 | WP_000590122.1 | hypothetical protein | - |
| H7684_RS11880 (H7684_11880) | - | 2431530..2431730 (-) | 201 | WP_000265043.1 | DUF1514 family protein | - |
| H7684_RS11885 (H7684_11885) | - | 2431730..2431879 (-) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| H7684_RS11890 (H7684_11890) | - | 2431876..2432262 (-) | 387 | WP_000592207.1 | hypothetical protein | - |
| H7684_RS11895 (H7684_11895) | - | 2432259..2432465 (-) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| H7684_RS11900 (H7684_11900) | - | 2432502..2433044 (-) | 543 | WP_000185659.1 | dUTP pyrophosphatase | - |
| H7684_RS11905 (H7684_11905) | - | 2433037..2433219 (-) | 183 | WP_000028422.1 | hypothetical protein | - |
| H7684_RS11910 (H7684_11910) | - | 2433209..2433460 (-) | 252 | WP_001065091.1 | DUF1024 family protein | - |
| H7684_RS11915 (H7684_11915) | - | 2433453..2433620 (-) | 168 | WP_001624242.1 | hypothetical protein | - |
| H7684_RS11920 (H7684_11920) | - | 2433632..2433874 (-) | 243 | WP_000131366.1 | SAV1978 family virulence-associated passenger protein | - |
| H7684_RS11925 (H7684_11925) | - | 2433878..2434246 (-) | 369 | WP_000101274.1 | SA1788 family PVL leukocidin-associated protein | - |
| H7684_RS11930 (H7684_11930) | - | 2434314..2434580 (-) | 267 | Protein_2328 | RusA family crossover junction endodeoxyribonuclease | - |
| H7684_RS11935 (H7684_11935) | - | 2434577..2434795 (-) | 219 | WP_000338531.1 | hypothetical protein | - |
| H7684_RS11940 (H7684_11940) | - | 2434802..2435686 (-) | 885 | WP_000148316.1 | DnaD domain protein | - |
| H7684_RS11945 (H7684_11945) | ssbA | 2435716..2436186 (-) | 471 | WP_000934764.1 | single-stranded DNA-binding protein | Machinery gene |
| H7684_RS11950 (H7684_11950) | - | 2436187..2436804 (-) | 618 | WP_071621397.1 | MBL fold metallo-hydrolase | - |
| H7684_RS11955 (H7684_11955) | - | 2436885..2437805 (-) | 921 | WP_000138472.1 | recombinase RecT | - |
| H7684_RS11960 (H7684_11960) | - | 2437807..2439750 (-) | 1944 | WP_000700577.1 | AAA family ATPase | - |
| H7684_RS11965 (H7684_11965) | - | 2439759..2440022 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| H7684_RS11970 (H7684_11970) | - | 2440031..2440291 (-) | 261 | WP_000291503.1 | DUF1108 family protein | - |
| H7684_RS11975 (H7684_11975) | - | 2440272..2440598 (-) | 327 | WP_000165375.1 | DUF2482 family protein | - |
| H7684_RS11980 (H7684_11980) | - | 2440693..2440854 (-) | 162 | WP_000066017.1 | DUF1270 domain-containing protein | - |
| H7684_RS11985 (H7684_11985) | - | 2440851..2441171 (-) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| H7684_RS11990 (H7684_11990) | - | 2441230..2441862 (+) | 633 | WP_000275058.1 | hypothetical protein | - |
| H7684_RS11995 (H7684_11995) | - | 2441877..2442017 (-) | 141 | WP_000939496.1 | hypothetical protein | - |
| H7684_RS12000 (H7684_12000) | - | 2442048..2442245 (-) | 198 | WP_001148855.1 | hypothetical protein | - |
| H7684_RS12005 (H7684_12005) | - | 2442261..2443013 (-) | 753 | WP_001148605.1 | phage antirepressor KilAC domain-containing protein | - |
| H7684_RS12010 (H7684_12010) | - | 2443064..2443393 (+) | 330 | WP_000128907.1 | hypothetical protein | - |
| H7684_RS12015 (H7684_12015) | - | 2443382..2443597 (-) | 216 | WP_001025874.1 | MW1434 family type I TA system toxin | - |
| H7684_RS12020 (H7684_12020) | - | 2443613..2443876 (-) | 264 | WP_000854072.1 | helix-turn-helix transcriptional regulator | - |
| H7684_RS12025 (H7684_12025) | - | 2443873..2444046 (-) | 174 | WP_001801500.1 | hypothetical protein | - |
| H7684_RS12030 (H7684_12030) | - | 2444009..2444722 (+) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| H7684_RS12035 (H7684_12035) | - | 2444738..2445670 (+) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| H7684_RS12040 (H7684_12040) | - | 2445676..2446017 (+) | 342 | WP_000591749.1 | hypothetical protein | - |
| H7684_RS12045 (H7684_12045) | - | 2446221..2446403 (+) | 183 | WP_000705248.1 | hypothetical protein | - |
| H7684_RS12050 (H7684_12050) | - | 2446503..2446967 (+) | 465 | WP_000825947.1 | hypothetical protein | - |
| H7684_RS12055 (H7684_12055) | - | 2447026..2448063 (+) | 1038 | WP_000857191.1 | site-specific integrase | - |
| H7684_RS12060 (H7684_12060) | sph | 2448114..2448944 (+) | 831 | Protein_2354 | sphingomyelin phosphodiesterase | - |
| H7684_RS12065 (H7684_12065) | lukG | 2449182..2450198 (-) | 1017 | WP_000595392.1 | bi-component leukocidin LukGH subunit G | - |
| H7684_RS12070 (H7684_12070) | lukH | 2450220..2451275 (-) | 1056 | WP_000791411.1 | bi-component leukocidin LukGH subunit H | - |
| H7684_RS12075 (H7684_12075) | - | 2451711..2452934 (+) | 1224 | WP_000206625.1 | ArgE/DapE family deacylase | - |
| H7684_RS12080 (H7684_12080) | - | 2453378..2454685 (+) | 1308 | WP_001045079.1 | TrkH family potassium uptake protein | - |
| H7684_RS12085 (H7684_12085) | groL | 2455225..2456841 (-) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| H7684_RS12090 (H7684_12090) | groES | 2456917..2457201 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17627.49 Da Isoelectric Point: 5.2672
>NTDB_id=475178 H7684_RS11945 WP_000934764.1 2435716..2436186(-) (ssbA) [Staphylococcus aureus strain KZN]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=475178 H7684_RS11945 WP_000934764.1 2435716..2436186(-) (ssbA) [Staphylococcus aureus strain KZN]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.558 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Neisseria meningitidis MC58 |
33.526 |
100 |
0.372 |
| ssb | Neisseria gonorrhoeae MS11 |
33.526 |
100 |
0.372 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |
| ssb | Vibrio cholerae strain A1552 |
31.492 |
100 |
0.365 |