Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | H7X57_RS07150 | Genome accession | NZ_CP060270 |
| Coordinates | 1408550..1408729 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain SP1384 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1408550..1449167 | 1408550..1408729 | within | 0 |
Gene organization within MGE regions
Location: 1408550..1449167
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7X57_RS07150 (H7X57_07105) | prx | 1408550..1408729 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| H7X57_RS07155 (H7X57_07110) | sda1 | 1408968..1410140 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| H7X57_RS07160 (H7X57_07115) | - | 1410256..1411452 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| H7X57_RS07165 (H7X57_07120) | - | 1411563..1411748 (-) | 186 | WP_002988802.1 | holin | - |
| H7X57_RS07170 (H7X57_07125) | - | 1411745..1412044 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| H7X57_RS07175 (H7X57_07130) | - | 1412055..1412675 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| H7X57_RS07180 (H7X57_07135) | - | 1412678..1412839 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| H7X57_RS07185 (H7X57_07140) | - | 1412848..1414755 (-) | 1908 | WP_206285685.1 | gp58-like family protein | - |
| H7X57_RS07190 (H7X57_07145) | - | 1414766..1415401 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| H7X57_RS07195 (H7X57_07150) | - | 1415401..1416456 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| H7X57_RS07200 (H7X57_07155) | - | 1416453..1418435 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| H7X57_RS07205 (H7X57_07160) | - | 1418445..1419287 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| H7X57_RS07210 (H7X57_07165) | - | 1419299..1423681 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| H7X57_RS07215 (H7X57_07170) | - | 1423696..1423929 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| H7X57_RS07220 (H7X57_07175) | - | 1424004..1424459 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| H7X57_RS07225 (H7X57_07180) | - | 1424513..1425112 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| H7X57_RS07230 (H7X57_07185) | - | 1425124..1425483 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| H7X57_RS07235 (H7X57_07190) | - | 1425487..1425831 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| H7X57_RS07240 (H7X57_07195) | - | 1425828..1426106 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| H7X57_RS07245 (H7X57_07200) | - | 1426117..1426473 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| H7X57_RS07250 (H7X57_07205) | - | 1426485..1427372 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| H7X57_RS07255 (H7X57_07210) | - | 1427385..1427954 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| H7X57_RS07260 (H7X57_07215) | - | 1428035..1428376 (-) | 342 | WP_241007341.1 | hypothetical protein | - |
| H7X57_RS07265 (H7X57_07220) | - | 1428379..1428567 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| H7X57_RS07270 (H7X57_07225) | - | 1428598..1430043 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| H7X57_RS07275 (H7X57_07230) | - | 1430003..1431535 (-) | 1533 | WP_076639992.1 | phage portal protein | - |
| H7X57_RS07280 (H7X57_07235) | - | 1431551..1432829 (-) | 1279 | Protein_1385 | PBSX family phage terminase large subunit | - |
| H7X57_RS07285 (H7X57_07240) | - | 1432819..1433271 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| H7X57_RS07290 (H7X57_07245) | - | 1433361..1433777 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| H7X57_RS07295 (H7X57_07250) | - | 1433774..1433965 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| H7X57_RS07300 (H7X57_07255) | - | 1433955..1434806 (-) | 852 | WP_002988740.1 | DNA-methyltransferase | - |
| H7X57_RS07305 (H7X57_07260) | - | 1434815..1435081 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| H7X57_RS07310 (H7X57_07265) | - | 1435078..1435245 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| H7X57_RS07315 (H7X57_07270) | - | 1435246..1436568 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| H7X57_RS07320 (H7X57_07275) | - | 1436565..1436840 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| H7X57_RS07325 (H7X57_07280) | - | 1437227..1439611 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| H7X57_RS07330 (H7X57_07285) | - | 1439616..1441538 (-) | 1923 | WP_272148496.1 | DNA polymerase | - |
| H7X57_RS07335 (H7X57_07290) | - | 1441581..1442138 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| H7X57_RS07340 (H7X57_07295) | - | 1442149..1442547 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| H7X57_RS07345 (H7X57_07300) | - | 1442551..1443705 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| H7X57_RS07350 (H7X57_07305) | - | 1443705..1444004 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| H7X57_RS07355 (H7X57_07310) | - | 1444092..1444295 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| H7X57_RS07360 (H7X57_07315) | - | 1444441..1444827 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| H7X57_RS07365 (H7X57_07320) | - | 1444824..1445027 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| H7X57_RS07370 (H7X57_07325) | - | 1445020..1445190 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| H7X57_RS07375 (H7X57_07330) | - | 1445187..1445462 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| H7X57_RS07380 (H7X57_07335) | - | 1445524..1445739 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| H7X57_RS07385 (H7X57_07340) | - | 1445787..1446200 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| H7X57_RS07390 (H7X57_07345) | - | 1446181..1446336 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| H7X57_RS07395 (H7X57_07350) | - | 1446662..1447012 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| H7X57_RS07400 (H7X57_07355) | - | 1447026..1447409 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| H7X57_RS07405 (H7X57_07360) | - | 1447420..1447971 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| H7X57_RS07410 (H7X57_07365) | - | 1448088..1449167 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=475068 H7X57_RS07150 WP_002988813.1 1408550..1408729(-) (prx) [Streptococcus pyogenes strain SP1384]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=475068 H7X57_RS07150 WP_002988813.1 1408550..1408729(-) (prx) [Streptococcus pyogenes strain SP1384]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |