Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | H7X57_RS05045 | Genome accession | NZ_CP060270 |
| Coordinates | 1007132..1007320 (-) | Length | 62 a.a. |
| NCBI ID | WP_011285559.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain SP1384 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 999548..1045858 | 1007132..1007320 | within | 0 |
Gene organization within MGE regions
Location: 999548..1045858
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7X57_RS05010 (H7X57_04990) | pfkA | 999548..1000561 (-) | 1014 | WP_010922375.1 | 6-phosphofructokinase | - |
| H7X57_RS05015 (H7X57_04995) | - | 1000641..1003751 (-) | 3111 | WP_010922376.1 | DNA polymerase III subunit alpha | - |
| H7X57_RS05020 (H7X57_05000) | - | 1003936..1004307 (+) | 372 | WP_010922377.1 | GntR family transcriptional regulator | - |
| H7X57_RS05025 (H7X57_05005) | - | 1004307..1005005 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| H7X57_RS05030 (H7X57_05010) | - | 1005015..1005800 (+) | 786 | WP_010922378.1 | hypothetical protein | - |
| H7X57_RS05035 (H7X57_05015) | - | 1005927..1006541 (-) | 615 | WP_011285558.1 | TVP38/TMEM64 family protein | - |
| H7X57_RS05045 (H7X57_05025) | prx | 1007132..1007320 (-) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| H7X57_RS05050 (H7X57_05030) | speA | 1007540..1008295 (+) | 756 | WP_011285560.1 | streptococcal pyrogenic exotoxin SpeA | - |
| H7X57_RS05055 (H7X57_05035) | - | 1008417..1009076 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| H7X57_RS05060 (H7X57_05040) | - | 1009076..1009297 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| H7X57_RS05065 (H7X57_05045) | - | 1009307..1010080 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| H7X57_RS05070 (H7X57_05050) | - | 1010091..1010693 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| H7X57_RS05075 (H7X57_05055) | - | 1010705..1011469 (-) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| H7X57_RS05080 (H7X57_05060) | - | 1011471..1011803 (-) | 333 | WP_011285562.1 | phage holin | - |
| H7X57_RS05085 (H7X57_05065) | - | 1011803..1012126 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| H7X57_RS05090 | - | 1012140..1012262 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| H7X57_RS05095 (H7X57_05070) | - | 1012276..1012623 (-) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| H7X57_RS05100 (H7X57_05075) | - | 1012634..1014496 (-) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| H7X57_RS05105 (H7X57_05080) | - | 1014501..1017941 (-) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| H7X57_RS05110 (H7X57_05085) | - | 1017942..1019426 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| H7X57_RS05115 (H7X57_05090) | - | 1019427..1021232 (-) | 1806 | WP_011054802.1 | phage tail protein | - |
| H7X57_RS05120 (H7X57_05095) | - | 1021225..1021683 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| H7X57_RS05125 (H7X57_05100) | - | 1021656..1021973 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| H7X57_RS05130 (H7X57_05105) | - | 1021986..1022492 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| H7X57_RS05135 (H7X57_05110) | - | 1022504..1022914 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| H7X57_RS05140 (H7X57_05115) | - | 1022916..1023311 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| H7X57_RS05145 (H7X57_05120) | - | 1023308..1023619 (-) | 312 | WP_011285567.1 | hypothetical protein | - |
| H7X57_RS05150 (H7X57_05125) | - | 1023616..1023960 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| H7X57_RS05155 (H7X57_05130) | - | 1023974..1024267 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| H7X57_RS05160 (H7X57_05135) | - | 1024280..1025170 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| H7X57_RS05165 (H7X57_05140) | - | 1025189..1025758 (-) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| H7X57_RS05170 | - | 1025867..1026001 (-) | 135 | WP_015055956.1 | hypothetical protein | - |
| H7X57_RS05175 (H7X57_05145) | - | 1026003..1026272 (-) | 270 | WP_011285568.1 | hypothetical protein | - |
| H7X57_RS05180 (H7X57_05150) | - | 1026279..1027187 (-) | 909 | WP_011285569.1 | minor capsid protein | - |
| H7X57_RS05185 (H7X57_05155) | - | 1027156..1028481 (-) | 1326 | WP_011285570.1 | phage portal protein | - |
| H7X57_RS05190 (H7X57_05160) | - | 1028481..1029755 (-) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| H7X57_RS05195 (H7X57_05165) | - | 1029745..1030125 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| H7X57_RS05200 (H7X57_05170) | - | 1030735..1031169 (-) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| H7X57_RS05205 (H7X57_05175) | - | 1031455..1031721 (-) | 267 | WP_011018131.1 | hypothetical protein | - |
| H7X57_RS05210 (H7X57_05180) | - | 1031718..1032242 (-) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| H7X57_RS05215 (H7X57_05185) | - | 1032245..1032877 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| H7X57_RS05220 (H7X57_05190) | - | 1032879..1033163 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| H7X57_RS05225 (H7X57_05195) | - | 1033160..1033330 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| H7X57_RS05230 (H7X57_05200) | - | 1033327..1033563 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| H7X57_RS09255 | - | 1033563..1033808 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| H7X57_RS05235 (H7X57_05205) | - | 1033805..1034161 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| H7X57_RS05240 (H7X57_05210) | - | 1034158..1034598 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| H7X57_RS05245 (H7X57_05215) | - | 1034598..1034801 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| H7X57_RS05250 (H7X57_05220) | ssb | 1034807..1035232 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| H7X57_RS05255 (H7X57_05225) | - | 1035225..1035899 (-) | 675 | WP_011285576.1 | ERF family protein | - |
| H7X57_RS05260 (H7X57_05230) | - | 1035900..1036382 (-) | 483 | WP_011285577.1 | siphovirus Gp157 family protein | - |
| H7X57_RS05265 (H7X57_05235) | - | 1036404..1036658 (-) | 255 | WP_011285578.1 | hypothetical protein | - |
| H7X57_RS05270 (H7X57_05240) | - | 1036639..1036992 (-) | 354 | WP_011285579.1 | hypothetical protein | - |
| H7X57_RS05275 (H7X57_05245) | - | 1037133..1037915 (-) | 783 | WP_011285581.1 | ATP-binding protein | - |
| H7X57_RS05280 (H7X57_05250) | - | 1037902..1038732 (-) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| H7X57_RS05285 | - | 1038746..1038934 (-) | 189 | Protein_997 | XRE family transcriptional regulator | - |
| H7X57_RS05290 | - | 1039168..1039407 (+) | 240 | WP_227874181.1 | hypothetical protein | - |
| H7X57_RS05295 (H7X57_05260) | - | 1039538..1039747 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| H7X57_RS05300 (H7X57_05265) | - | 1039857..1040057 (-) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| H7X57_RS05305 (H7X57_05270) | - | 1040131..1040517 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| H7X57_RS05310 (H7X57_05275) | - | 1040506..1040715 (-) | 210 | WP_011284881.1 | hypothetical protein | - |
| H7X57_RS05315 (H7X57_05280) | - | 1040769..1041368 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| H7X57_RS05320 (H7X57_05285) | - | 1041398..1041556 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| H7X57_RS05325 (H7X57_05290) | - | 1041913..1042737 (+) | 825 | WP_011285584.1 | XRE family transcriptional regulator | - |
| H7X57_RS05330 (H7X57_05295) | - | 1042773..1043666 (+) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| H7X57_RS05335 (H7X57_05300) | - | 1043787..1044875 (+) | 1089 | WP_011054595.1 | site-specific integrase | - |
| H7X57_RS05340 (H7X57_05305) | - | 1045238..1045858 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7290.41 Da Isoelectric Point: 4.3313
>NTDB_id=475057 H7X57_RS05045 WP_011285559.1 1007132..1007320(-) (prx) [Streptococcus pyogenes strain SP1384]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=475057 H7X57_RS05045 WP_011285559.1 1007132..1007320(-) (prx) [Streptococcus pyogenes strain SP1384]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
95.161 |
0.952 |
| prx | Streptococcus pyogenes MGAS315 |
79.032 |
100 |
0.79 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
95.161 |
0.71 |
| prx | Streptococcus pyogenes MGAS315 |
69.492 |
95.161 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
66.129 |
0.548 |