Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | H7X56_RS07145 | Genome accession | NZ_CP060269 |
| Coordinates | 1408490..1408669 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain SP1380 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1408490..1449106 | 1408490..1408669 | within | 0 |
Gene organization within MGE regions
Location: 1408490..1449106
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7X56_RS07145 (H7X56_07105) | prx | 1408490..1408669 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| H7X56_RS07150 (H7X56_07110) | sda1 | 1408908..1410080 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| H7X56_RS07155 (H7X56_07115) | - | 1410196..1411392 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| H7X56_RS07160 (H7X56_07120) | - | 1411503..1411688 (-) | 186 | WP_002988802.1 | holin | - |
| H7X56_RS07165 (H7X56_07125) | - | 1411685..1411984 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| H7X56_RS07170 (H7X56_07130) | - | 1411995..1412615 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| H7X56_RS07175 (H7X56_07135) | - | 1412618..1412779 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| H7X56_RS07180 (H7X56_07140) | - | 1412788..1414695 (-) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| H7X56_RS07185 (H7X56_07145) | - | 1414706..1415341 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| H7X56_RS07190 (H7X56_07150) | - | 1415341..1416396 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| H7X56_RS07195 (H7X56_07155) | - | 1416393..1418375 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| H7X56_RS07200 (H7X56_07160) | - | 1418385..1419227 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| H7X56_RS07205 (H7X56_07165) | - | 1419239..1423621 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| H7X56_RS07210 (H7X56_07170) | - | 1423636..1423869 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| H7X56_RS07215 (H7X56_07175) | - | 1423944..1424399 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| H7X56_RS07220 (H7X56_07180) | - | 1424453..1425052 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| H7X56_RS07225 (H7X56_07185) | - | 1425064..1425423 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| H7X56_RS07230 (H7X56_07190) | - | 1425427..1425771 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| H7X56_RS07235 (H7X56_07195) | - | 1425768..1426046 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| H7X56_RS07240 (H7X56_07200) | - | 1426057..1426413 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| H7X56_RS07245 (H7X56_07205) | - | 1426425..1427312 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| H7X56_RS07250 (H7X56_07210) | - | 1427325..1427894 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| H7X56_RS07255 (H7X56_07215) | - | 1428050..1428316 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| H7X56_RS07260 (H7X56_07220) | - | 1428319..1428507 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| H7X56_RS07265 (H7X56_07225) | - | 1428538..1429983 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| H7X56_RS07270 (H7X56_07230) | - | 1429943..1431475 (-) | 1533 | WP_076639992.1 | phage portal protein | - |
| H7X56_RS07275 (H7X56_07235) | - | 1431491..1432768 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| H7X56_RS07280 (H7X56_07240) | - | 1432758..1433210 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| H7X56_RS07285 (H7X56_07245) | - | 1433300..1433716 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| H7X56_RS07290 (H7X56_07250) | - | 1433713..1433904 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| H7X56_RS07295 (H7X56_07255) | - | 1433894..1434745 (-) | 852 | WP_002988740.1 | DNA-methyltransferase | - |
| H7X56_RS07300 (H7X56_07260) | - | 1434754..1435020 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| H7X56_RS07305 (H7X56_07265) | - | 1435017..1435184 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| H7X56_RS07310 (H7X56_07270) | - | 1435185..1436507 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| H7X56_RS07315 (H7X56_07275) | - | 1436504..1436779 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| H7X56_RS07320 (H7X56_07280) | - | 1437166..1439550 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| H7X56_RS07325 (H7X56_07285) | - | 1439555..1441477 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| H7X56_RS07330 (H7X56_07290) | - | 1441520..1442077 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| H7X56_RS07335 (H7X56_07295) | - | 1442088..1442486 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| H7X56_RS07340 (H7X56_07300) | - | 1442490..1443644 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| H7X56_RS07345 (H7X56_07305) | - | 1443644..1443943 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| H7X56_RS07350 (H7X56_07310) | - | 1444031..1444234 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| H7X56_RS07355 (H7X56_07320) | - | 1444380..1444766 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| H7X56_RS07360 (H7X56_07325) | - | 1444763..1444966 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| H7X56_RS07365 (H7X56_07330) | - | 1444959..1445129 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| H7X56_RS07370 (H7X56_07335) | - | 1445126..1445401 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| H7X56_RS07375 (H7X56_07340) | - | 1445463..1445678 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| H7X56_RS07380 (H7X56_07345) | - | 1445726..1446139 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| H7X56_RS07385 (H7X56_07350) | - | 1446120..1446275 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| H7X56_RS07390 (H7X56_07355) | - | 1446601..1446951 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| H7X56_RS07395 (H7X56_07360) | - | 1446965..1447348 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| H7X56_RS07400 (H7X56_07365) | - | 1447359..1447910 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| H7X56_RS07405 (H7X56_07370) | - | 1448027..1449106 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=475011 H7X56_RS07145 WP_002988813.1 1408490..1408669(-) (prx) [Streptococcus pyogenes strain SP1380]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=475011 H7X56_RS07145 WP_002988813.1 1408490..1408669(-) (prx) [Streptococcus pyogenes strain SP1380]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |