Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | H7X56_RS05875 | Genome accession | NZ_CP060269 |
| Coordinates | 1168813..1168995 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain SP1380 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1168813..1203823 | 1168813..1168995 | within | 0 |
Gene organization within MGE regions
Location: 1168813..1203823
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7X56_RS05875 (H7X56_05840) | prx | 1168813..1168995 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| H7X56_RS05880 (H7X56_05845) | sda3 | 1169234..1170034 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| H7X56_RS05885 (H7X56_05850) | - | 1170305..1170739 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| H7X56_RS05890 (H7X56_05855) | - | 1170809..1172014 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| H7X56_RS05895 (H7X56_05860) | - | 1172130..1172357 (-) | 228 | WP_003058873.1 | phage holin | - |
| H7X56_RS05900 (H7X56_05865) | - | 1172354..1172629 (-) | 276 | WP_002987582.1 | DUF7365 family protein | - |
| H7X56_RS05905 (H7X56_05870) | - | 1172639..1173256 (-) | 618 | WP_011285613.1 | DUF1366 domain-containing protein | - |
| H7X56_RS05910 (H7X56_05875) | - | 1173253..1173690 (-) | 438 | WP_011285614.1 | DUF1617 family protein | - |
| H7X56_RS05915 (H7X56_05880) | - | 1173702..1175318 (-) | 1617 | WP_015446227.1 | gp58-like family protein | - |
| H7X56_RS09635 | - | 1175325..1175570 (-) | 246 | Protein_1126 | phage tail spike protein | - |
| H7X56_RS05920 (H7X56_05885) | - | 1175567..1176262 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| H7X56_RS05925 (H7X56_05890) | - | 1176259..1178616 (-) | 2358 | WP_010922453.1 | phage tail protein | - |
| H7X56_RS05930 (H7X56_05895) | - | 1178616..1178987 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| H7X56_RS05935 (H7X56_05900) | - | 1179002..1179265 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| H7X56_RS05940 (H7X56_05905) | - | 1179276..1179869 (-) | 594 | WP_010922456.1 | tail protein | - |
| H7X56_RS05945 (H7X56_05910) | - | 1179881..1180216 (-) | 336 | WP_011285616.1 | hypothetical protein | - |
| H7X56_RS05950 (H7X56_05915) | - | 1180217..1180453 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| H7X56_RS05955 (H7X56_05920) | - | 1180446..1180784 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| H7X56_RS05960 (H7X56_05925) | - | 1180744..1181166 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| H7X56_RS05965 (H7X56_05930) | - | 1181176..1181376 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| H7X56_RS05970 (H7X56_05935) | - | 1181376..1182287 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| H7X56_RS05975 (H7X56_05940) | - | 1182312..1182773 (-) | 462 | WP_011285618.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| H7X56_RS05980 (H7X56_05945) | - | 1182854..1184269 (-) | 1416 | WP_011285619.1 | terminase | - |
| H7X56_RS05985 (H7X56_05950) | - | 1184379..1184645 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| H7X56_RS05990 (H7X56_05955) | - | 1184638..1184817 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| H7X56_RS05995 (H7X56_05960) | - | 1184867..1185091 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| H7X56_RS06000 (H7X56_05965) | - | 1185097..1186590 (-) | 1494 | WP_015446231.1 | hypothetical protein | - |
| H7X56_RS06005 (H7X56_05970) | - | 1186583..1187851 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| H7X56_RS06010 (H7X56_05975) | - | 1187848..1188204 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| H7X56_RS06015 (H7X56_05980) | - | 1188353..1188697 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| H7X56_RS06020 (H7X56_05985) | - | 1188806..1189225 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| H7X56_RS06025 (H7X56_05990) | - | 1189493..1190128 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| H7X56_RS06030 (H7X56_05995) | - | 1190130..1190399 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| H7X56_RS06035 (H7X56_06000) | - | 1190483..1190995 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| H7X56_RS06040 (H7X56_06005) | - | 1190992..1191333 (-) | 342 | WP_002988364.1 | hypothetical protein | - |
| H7X56_RS06045 (H7X56_06010) | - | 1191511..1191678 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| H7X56_RS06050 (H7X56_06015) | - | 1191688..1192485 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| H7X56_RS06055 (H7X56_06020) | - | 1192482..1193411 (-) | 930 | WP_272105711.1 | recombinase RecT | - |
| H7X56_RS06060 (H7X56_06025) | - | 1193414..1193743 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| H7X56_RS06065 (H7X56_06030) | - | 1193799..1194005 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| H7X56_RS06070 (H7X56_06035) | - | 1194014..1194154 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| H7X56_RS06075 (H7X56_06040) | - | 1194151..1194384 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| H7X56_RS06080 (H7X56_06045) | - | 1194365..1194754 (-) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| H7X56_RS06085 | - | 1194899..1195138 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| H7X56_RS06090 (H7X56_06050) | - | 1195238..1195423 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| H7X56_RS06095 (H7X56_06055) | - | 1195425..1195736 (-) | 312 | WP_002990080.1 | hypothetical protein | - |
| H7X56_RS06100 (H7X56_06060) | - | 1195814..1195999 (-) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| H7X56_RS06105 (H7X56_06065) | - | 1196166..1196405 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| H7X56_RS06110 (H7X56_06070) | - | 1196547..1197353 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| H7X56_RS06115 (H7X56_06075) | - | 1197288..1197554 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| H7X56_RS06120 (H7X56_06080) | - | 1197586..1198302 (-) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| H7X56_RS06125 (H7X56_06085) | - | 1198314..1198505 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| H7X56_RS06130 (H7X56_06090) | - | 1199141..1199236 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| H7X56_RS06135 (H7X56_06095) | - | 1199659..1200006 (+) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| H7X56_RS06140 (H7X56_06100) | - | 1200010..1200390 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| H7X56_RS06145 (H7X56_06105) | - | 1200402..1200668 (+) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| H7X56_RS06150 (H7X56_06110) | - | 1200792..1201934 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| H7X56_RS06155 (H7X56_06115) | - | 1202024..1202299 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| H7X56_RS06160 (H7X56_06120) | - | 1202398..1202985 (-) | 588 | WP_010922482.1 | YpmS family protein | - |
| H7X56_RS06165 (H7X56_06125) | - | 1202963..1203805 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=475004 H7X56_RS05875 WP_011017964.1 1168813..1168995(-) (prx) [Streptococcus pyogenes strain SP1380]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=475004 H7X56_RS05875 WP_011017964.1 1168813..1168995(-) (prx) [Streptococcus pyogenes strain SP1380]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |