Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | H7X58_RS07340 | Genome accession | NZ_CP060268 |
| Coordinates | 1444924..1445103 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain SP1426 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1444924..1485540 | 1444924..1445103 | within | 0 |
Gene organization within MGE regions
Location: 1444924..1485540
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7X58_RS07340 (H7X58_07295) | prx | 1444924..1445103 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| H7X58_RS07345 (H7X58_07300) | sda1 | 1445342..1446514 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| H7X58_RS07350 (H7X58_07305) | - | 1446630..1447826 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| H7X58_RS07355 (H7X58_07310) | - | 1447937..1448122 (-) | 186 | WP_002988802.1 | holin | - |
| H7X58_RS07360 (H7X58_07315) | - | 1448119..1448418 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| H7X58_RS07365 (H7X58_07320) | - | 1448429..1449049 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| H7X58_RS07370 (H7X58_07325) | - | 1449052..1449213 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| H7X58_RS07375 (H7X58_07330) | - | 1449222..1451129 (-) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| H7X58_RS07380 (H7X58_07335) | - | 1451140..1451775 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| H7X58_RS07385 (H7X58_07340) | - | 1451775..1452830 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| H7X58_RS07390 (H7X58_07345) | - | 1452827..1454809 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| H7X58_RS07395 (H7X58_07350) | - | 1454819..1455661 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| H7X58_RS07400 (H7X58_07355) | - | 1455673..1460055 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| H7X58_RS07405 (H7X58_07360) | - | 1460070..1460303 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| H7X58_RS07410 (H7X58_07365) | - | 1460378..1460833 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| H7X58_RS07415 (H7X58_07370) | - | 1460887..1461486 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| H7X58_RS07420 (H7X58_07375) | - | 1461498..1461857 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| H7X58_RS07425 (H7X58_07380) | - | 1461861..1462205 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| H7X58_RS07430 (H7X58_07385) | - | 1462202..1462480 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| H7X58_RS07435 (H7X58_07390) | - | 1462491..1462847 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| H7X58_RS07440 (H7X58_07395) | - | 1462859..1463746 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| H7X58_RS07445 (H7X58_07400) | - | 1463759..1464328 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| H7X58_RS07450 (H7X58_07405) | - | 1464484..1464750 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| H7X58_RS07455 (H7X58_07410) | - | 1464753..1464941 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| H7X58_RS07460 (H7X58_07415) | - | 1464972..1466417 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| H7X58_RS07465 (H7X58_07420) | - | 1466377..1467909 (-) | 1533 | WP_002988758.1 | phage portal protein | - |
| H7X58_RS07470 (H7X58_07425) | - | 1467925..1469202 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| H7X58_RS07475 (H7X58_07430) | - | 1469192..1469644 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| H7X58_RS07480 (H7X58_07435) | - | 1469734..1470150 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| H7X58_RS07485 (H7X58_07440) | - | 1470147..1470338 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| H7X58_RS07490 (H7X58_07445) | - | 1470328..1471179 (-) | 852 | WP_002988740.1 | DNA-methyltransferase | - |
| H7X58_RS07495 (H7X58_07450) | - | 1471188..1471454 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| H7X58_RS07500 (H7X58_07455) | - | 1471451..1471618 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| H7X58_RS07505 (H7X58_07460) | - | 1471619..1472941 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| H7X58_RS07510 (H7X58_07465) | - | 1472938..1473213 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| H7X58_RS07515 (H7X58_07470) | - | 1473600..1475984 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| H7X58_RS07520 (H7X58_07475) | - | 1475989..1477911 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| H7X58_RS07525 (H7X58_07480) | - | 1477954..1478511 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| H7X58_RS07530 (H7X58_07485) | - | 1478522..1478920 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| H7X58_RS07535 (H7X58_07490) | - | 1478924..1480078 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| H7X58_RS07540 (H7X58_07495) | - | 1480078..1480377 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| H7X58_RS07545 (H7X58_07500) | - | 1480465..1480668 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| H7X58_RS07550 (H7X58_07505) | - | 1480814..1481200 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| H7X58_RS07555 (H7X58_07510) | - | 1481197..1481400 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| H7X58_RS07560 (H7X58_07515) | - | 1481393..1481563 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| H7X58_RS07565 (H7X58_07520) | - | 1481560..1481835 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| H7X58_RS07570 (H7X58_07525) | - | 1481897..1482112 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| H7X58_RS07575 (H7X58_07530) | - | 1482160..1482573 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| H7X58_RS07580 (H7X58_07535) | - | 1482554..1482709 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| H7X58_RS07585 (H7X58_07540) | - | 1483035..1483385 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| H7X58_RS07590 (H7X58_07545) | - | 1483399..1483782 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| H7X58_RS07595 (H7X58_07550) | - | 1483793..1484344 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| H7X58_RS07600 (H7X58_07555) | - | 1484461..1485540 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=474955 H7X58_RS07340 WP_002988813.1 1444924..1445103(-) (prx) [Streptococcus pyogenes strain SP1426]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=474955 H7X58_RS07340 WP_002988813.1 1444924..1445103(-) (prx) [Streptococcus pyogenes strain SP1426]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |