Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | H7X58_RS06070 | Genome accession | NZ_CP060268 |
| Coordinates | 1205247..1205429 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain SP1426 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1205247..1238733 | 1205247..1205429 | within | 0 |
Gene organization within MGE regions
Location: 1205247..1238733
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7X58_RS06070 (H7X58_06030) | prx | 1205247..1205429 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| H7X58_RS06075 (H7X58_06035) | sda3 | 1205668..1206468 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| H7X58_RS06080 (H7X58_06040) | - | 1206739..1207173 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| H7X58_RS06085 (H7X58_06045) | - | 1207243..1208448 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| H7X58_RS06090 (H7X58_06050) | - | 1208564..1208791 (-) | 228 | WP_003058873.1 | phage holin | - |
| H7X58_RS06095 (H7X58_06055) | - | 1208788..1209063 (-) | 276 | WP_002987582.1 | DUF7365 family protein | - |
| H7X58_RS06100 (H7X58_06060) | - | 1209073..1209690 (-) | 618 | WP_011285613.1 | DUF1366 domain-containing protein | - |
| H7X58_RS06105 (H7X58_06065) | - | 1209687..1210124 (-) | 438 | WP_011285614.1 | DUF1617 family protein | - |
| H7X58_RS06110 (H7X58_06070) | - | 1210136..1212004 (-) | 1869 | WP_011285615.1 | gp58-like family protein | - |
| H7X58_RS06115 (H7X58_06075) | - | 1212001..1212696 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| H7X58_RS06120 (H7X58_06080) | - | 1212693..1215050 (-) | 2358 | WP_010922453.1 | phage tail protein | - |
| H7X58_RS06125 (H7X58_06085) | - | 1215050..1215421 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| H7X58_RS06130 (H7X58_06090) | - | 1215436..1215699 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| H7X58_RS06135 (H7X58_06095) | - | 1215710..1216303 (-) | 594 | WP_010922456.1 | tail protein | - |
| H7X58_RS06140 (H7X58_06100) | - | 1216315..1216650 (-) | 336 | WP_011285616.1 | hypothetical protein | - |
| H7X58_RS06145 (H7X58_06105) | - | 1216651..1216887 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| H7X58_RS06150 (H7X58_06110) | - | 1216880..1217218 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| H7X58_RS06155 (H7X58_06115) | - | 1217178..1217600 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| H7X58_RS06160 (H7X58_06120) | - | 1217610..1217810 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| H7X58_RS06165 (H7X58_06125) | - | 1217810..1218721 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| H7X58_RS06170 (H7X58_06130) | - | 1218746..1219207 (-) | 462 | WP_011285618.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| H7X58_RS06175 (H7X58_06135) | - | 1219288..1220703 (-) | 1416 | WP_011285619.1 | terminase | - |
| H7X58_RS06180 (H7X58_06140) | - | 1220813..1221079 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| H7X58_RS06185 (H7X58_06145) | - | 1221072..1221251 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| H7X58_RS06190 (H7X58_06150) | - | 1221301..1221525 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| H7X58_RS06195 (H7X58_06155) | - | 1221531..1223024 (-) | 1494 | WP_015446231.1 | hypothetical protein | - |
| H7X58_RS06200 (H7X58_06160) | - | 1223017..1224285 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| H7X58_RS06205 (H7X58_06165) | - | 1224282..1224638 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| H7X58_RS06210 (H7X58_06170) | - | 1224787..1225131 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| H7X58_RS06215 (H7X58_06175) | - | 1225240..1225659 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| H7X58_RS06220 (H7X58_06180) | - | 1225927..1226562 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| H7X58_RS06225 (H7X58_06185) | - | 1226564..1226833 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| H7X58_RS06230 (H7X58_06190) | - | 1226917..1227429 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| H7X58_RS06235 (H7X58_06195) | - | 1227426..1227767 (-) | 342 | WP_002988364.1 | hypothetical protein | - |
| H7X58_RS06240 (H7X58_06200) | - | 1227945..1228112 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| H7X58_RS06245 (H7X58_06205) | - | 1228122..1228919 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| H7X58_RS06250 (H7X58_06210) | - | 1228916..1229845 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| H7X58_RS06255 (H7X58_06215) | - | 1229848..1230177 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| H7X58_RS06260 (H7X58_06220) | - | 1230233..1230439 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| H7X58_RS06265 (H7X58_06225) | - | 1230448..1230588 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| H7X58_RS06270 (H7X58_06230) | - | 1230585..1230818 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| H7X58_RS06275 (H7X58_06235) | - | 1230799..1231188 (-) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| H7X58_RS06280 | - | 1231333..1231572 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| H7X58_RS06285 (H7X58_06240) | - | 1231672..1231857 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| H7X58_RS06290 (H7X58_06245) | - | 1231859..1232170 (-) | 312 | WP_002990080.1 | hypothetical protein | - |
| H7X58_RS06295 (H7X58_06250) | - | 1232248..1232433 (-) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| H7X58_RS06300 (H7X58_06255) | - | 1232600..1232839 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| H7X58_RS06305 (H7X58_06260) | - | 1232981..1233787 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| H7X58_RS06310 (H7X58_06265) | - | 1233722..1233988 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| H7X58_RS06315 (H7X58_06270) | - | 1234020..1234736 (-) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| H7X58_RS06320 (H7X58_06275) | - | 1234748..1234939 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| H7X58_RS06325 (H7X58_06280) | - | 1235575..1235670 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| H7X58_RS06330 (H7X58_06285) | - | 1236093..1236440 (+) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| H7X58_RS06335 (H7X58_06290) | - | 1236444..1236824 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| H7X58_RS06340 (H7X58_06295) | - | 1236836..1237102 (+) | 267 | WP_146708310.1 | DUF4177 domain-containing protein | - |
| H7X58_RS06345 (H7X58_06300) | - | 1237226..1238368 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| H7X58_RS06350 (H7X58_06305) | - | 1238458..1238733 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=474948 H7X58_RS06070 WP_011017964.1 1205247..1205429(-) (prx) [Streptococcus pyogenes strain SP1426]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=474948 H7X58_RS06070 WP_011017964.1 1205247..1205429(-) (prx) [Streptococcus pyogenes strain SP1426]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |