Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | H7X59_RS07145 | Genome accession | NZ_CP060267 |
| Coordinates | 1408558..1408737 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain SP1448 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1408558..1449174 | 1408558..1408737 | within | 0 |
Gene organization within MGE regions
Location: 1408558..1449174
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7X59_RS07145 (H7X59_07105) | prx | 1408558..1408737 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| H7X59_RS07150 (H7X59_07110) | sda1 | 1408976..1410148 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| H7X59_RS07155 (H7X59_07115) | - | 1410264..1411460 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| H7X59_RS07160 (H7X59_07120) | - | 1411571..1411756 (-) | 186 | WP_002988802.1 | holin | - |
| H7X59_RS07165 (H7X59_07125) | - | 1411753..1412052 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| H7X59_RS07170 (H7X59_07130) | - | 1412063..1412683 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| H7X59_RS07175 (H7X59_07135) | - | 1412686..1412847 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| H7X59_RS07180 (H7X59_07140) | - | 1412856..1414763 (-) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| H7X59_RS07185 (H7X59_07145) | - | 1414774..1415409 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| H7X59_RS07190 (H7X59_07150) | - | 1415409..1416464 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| H7X59_RS07195 (H7X59_07155) | - | 1416461..1418443 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| H7X59_RS07200 (H7X59_07160) | - | 1418453..1419295 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| H7X59_RS07205 (H7X59_07165) | - | 1419307..1423689 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| H7X59_RS07210 (H7X59_07170) | - | 1423704..1423937 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| H7X59_RS07215 (H7X59_07175) | - | 1424012..1424467 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| H7X59_RS07220 (H7X59_07180) | - | 1424521..1425120 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| H7X59_RS07225 (H7X59_07185) | - | 1425132..1425491 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| H7X59_RS07230 (H7X59_07190) | - | 1425495..1425839 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| H7X59_RS07235 (H7X59_07195) | - | 1425836..1426114 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| H7X59_RS07240 (H7X59_07200) | - | 1426125..1426481 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| H7X59_RS07245 (H7X59_07205) | - | 1426493..1427380 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| H7X59_RS07250 (H7X59_07210) | - | 1427393..1427962 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| H7X59_RS07255 (H7X59_07215) | - | 1428118..1428384 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| H7X59_RS07260 (H7X59_07220) | - | 1428387..1428575 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| H7X59_RS07265 (H7X59_07225) | - | 1428606..1430051 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| H7X59_RS07270 (H7X59_07230) | - | 1430011..1431543 (-) | 1533 | WP_076639992.1 | phage portal protein | - |
| H7X59_RS07275 (H7X59_07235) | - | 1431559..1432836 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| H7X59_RS07280 (H7X59_07240) | - | 1432826..1433278 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| H7X59_RS07285 (H7X59_07245) | - | 1433368..1433784 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| H7X59_RS07290 (H7X59_07250) | - | 1433781..1433972 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| H7X59_RS07295 (H7X59_07255) | - | 1433962..1434813 (-) | 852 | WP_002988740.1 | DNA-methyltransferase | - |
| H7X59_RS07300 (H7X59_07260) | - | 1434822..1435088 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| H7X59_RS07305 (H7X59_07265) | - | 1435085..1435252 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| H7X59_RS07310 (H7X59_07270) | - | 1435253..1436575 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| H7X59_RS07315 (H7X59_07275) | - | 1436572..1436847 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| H7X59_RS07320 (H7X59_07280) | - | 1437234..1439618 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| H7X59_RS07325 (H7X59_07285) | - | 1439623..1441545 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| H7X59_RS07330 (H7X59_07290) | - | 1441588..1442145 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| H7X59_RS07335 (H7X59_07295) | - | 1442156..1442554 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| H7X59_RS07340 (H7X59_07300) | - | 1442558..1443712 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| H7X59_RS07345 (H7X59_07305) | - | 1443712..1444011 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| H7X59_RS07350 (H7X59_07310) | - | 1444099..1444302 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| H7X59_RS07355 (H7X59_07315) | - | 1444448..1444834 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| H7X59_RS07360 (H7X59_07320) | - | 1444831..1445034 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| H7X59_RS07365 (H7X59_07325) | - | 1445027..1445197 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| H7X59_RS07370 (H7X59_07330) | - | 1445194..1445469 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| H7X59_RS07375 (H7X59_07335) | - | 1445531..1445746 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| H7X59_RS07380 (H7X59_07340) | - | 1445794..1446207 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| H7X59_RS07385 (H7X59_07345) | - | 1446188..1446343 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| H7X59_RS07390 (H7X59_07350) | - | 1446669..1447019 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| H7X59_RS07395 (H7X59_07355) | - | 1447033..1447416 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| H7X59_RS07400 (H7X59_07360) | - | 1447427..1447978 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| H7X59_RS07405 (H7X59_07365) | - | 1448095..1449174 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=474899 H7X59_RS07145 WP_002988813.1 1408558..1408737(-) (prx) [Streptococcus pyogenes strain SP1448]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=474899 H7X59_RS07145 WP_002988813.1 1408558..1408737(-) (prx) [Streptococcus pyogenes strain SP1448]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |