Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | H7X59_RS05875 | Genome accession | NZ_CP060267 |
| Coordinates | 1168881..1169063 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain SP1448 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1168881..1207707 | 1168881..1169063 | within | 0 |
Gene organization within MGE regions
Location: 1168881..1207707
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7X59_RS05875 (H7X59_05840) | prx | 1168881..1169063 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| H7X59_RS05880 (H7X59_05845) | sda3 | 1169302..1170102 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| H7X59_RS05885 (H7X59_05850) | - | 1170373..1170807 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| H7X59_RS05890 (H7X59_05855) | - | 1170877..1172082 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| H7X59_RS05895 (H7X59_05860) | - | 1172198..1172425 (-) | 228 | WP_003058873.1 | phage holin | - |
| H7X59_RS05900 (H7X59_05865) | - | 1172422..1172697 (-) | 276 | WP_002987582.1 | DUF7365 family protein | - |
| H7X59_RS05905 (H7X59_05870) | - | 1172707..1173324 (-) | 618 | WP_011285613.1 | DUF1366 domain-containing protein | - |
| H7X59_RS05910 (H7X59_05875) | - | 1173321..1173758 (-) | 438 | WP_011285614.1 | DUF1617 family protein | - |
| H7X59_RS05915 (H7X59_05880) | - | 1173770..1175638 (-) | 1869 | WP_011285615.1 | gp58-like family protein | - |
| H7X59_RS05920 (H7X59_05885) | - | 1175635..1176330 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| H7X59_RS05925 (H7X59_05890) | - | 1176327..1178684 (-) | 2358 | WP_010922453.1 | phage tail protein | - |
| H7X59_RS05930 (H7X59_05895) | - | 1178684..1179055 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| H7X59_RS05935 (H7X59_05900) | - | 1179070..1179333 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| H7X59_RS05940 (H7X59_05905) | - | 1179344..1179937 (-) | 594 | WP_010922456.1 | tail protein | - |
| H7X59_RS05945 (H7X59_05910) | - | 1179949..1180284 (-) | 336 | WP_011285616.1 | hypothetical protein | - |
| H7X59_RS05950 (H7X59_05915) | - | 1180285..1180521 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| H7X59_RS05955 (H7X59_05920) | - | 1180514..1180852 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| H7X59_RS05960 (H7X59_05925) | - | 1180812..1181234 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| H7X59_RS05965 (H7X59_05930) | - | 1181244..1181444 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| H7X59_RS05970 (H7X59_05935) | - | 1181444..1182355 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| H7X59_RS05975 (H7X59_05940) | - | 1182380..1182841 (-) | 462 | WP_011285618.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| H7X59_RS05980 (H7X59_05945) | - | 1182922..1184337 (-) | 1416 | WP_011285619.1 | terminase | - |
| H7X59_RS05985 (H7X59_05950) | - | 1184447..1184713 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| H7X59_RS05990 (H7X59_05955) | - | 1184706..1184885 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| H7X59_RS05995 (H7X59_05960) | - | 1184935..1185159 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| H7X59_RS06000 (H7X59_05965) | - | 1185165..1186658 (-) | 1494 | WP_015446231.1 | hypothetical protein | - |
| H7X59_RS06005 (H7X59_05970) | - | 1186651..1187919 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| H7X59_RS06010 (H7X59_05975) | - | 1187916..1188272 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| H7X59_RS06015 (H7X59_05980) | - | 1188421..1188765 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| H7X59_RS06020 (H7X59_05985) | - | 1188874..1189293 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| H7X59_RS06025 (H7X59_05990) | - | 1189561..1190196 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| H7X59_RS06030 (H7X59_05995) | - | 1190198..1190467 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| H7X59_RS06035 (H7X59_06000) | - | 1190551..1191063 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| H7X59_RS06040 (H7X59_06005) | - | 1191060..1191401 (-) | 342 | WP_002988364.1 | hypothetical protein | - |
| H7X59_RS06045 (H7X59_06010) | - | 1191579..1191746 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| H7X59_RS06050 (H7X59_06015) | - | 1191756..1192553 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| H7X59_RS06055 (H7X59_06020) | - | 1192550..1193479 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| H7X59_RS06060 (H7X59_06025) | - | 1193482..1193811 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| H7X59_RS06065 (H7X59_06030) | - | 1193867..1194073 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| H7X59_RS06070 (H7X59_06035) | - | 1194082..1194222 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| H7X59_RS06075 (H7X59_06040) | - | 1194219..1194452 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| H7X59_RS06080 (H7X59_06045) | - | 1194433..1194822 (-) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| H7X59_RS06085 | - | 1194967..1195206 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| H7X59_RS06090 (H7X59_06050) | - | 1195306..1195491 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| H7X59_RS06095 (H7X59_06055) | - | 1195493..1195804 (-) | 312 | WP_002990080.1 | hypothetical protein | - |
| H7X59_RS06100 (H7X59_06060) | - | 1195882..1196067 (-) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| H7X59_RS06105 (H7X59_06065) | - | 1196234..1196473 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| H7X59_RS06110 (H7X59_06070) | - | 1196615..1197421 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| H7X59_RS06115 (H7X59_06075) | - | 1197356..1197622 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| H7X59_RS06120 (H7X59_06080) | - | 1197654..1198370 (-) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| H7X59_RS06125 (H7X59_06085) | - | 1198382..1198573 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| H7X59_RS06130 (H7X59_06090) | - | 1199209..1199304 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| H7X59_RS06135 (H7X59_06095) | - | 1199727..1200074 (+) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| H7X59_RS06140 (H7X59_06100) | - | 1200078..1200458 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| H7X59_RS06145 (H7X59_06105) | - | 1200470..1200736 (+) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| H7X59_RS06150 (H7X59_06110) | - | 1200860..1202002 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| H7X59_RS06155 (H7X59_06115) | - | 1202092..1202367 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| H7X59_RS06160 (H7X59_06120) | - | 1202466..1203053 (-) | 588 | WP_010922482.1 | YpmS family protein | - |
| H7X59_RS06165 (H7X59_06125) | - | 1203031..1203873 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
| H7X59_RS06170 (H7X59_06130) | - | 1203866..1204705 (-) | 840 | WP_002989125.1 | DegV family protein | - |
| H7X59_RS06175 (H7X59_06135) | - | 1204933..1205874 (-) | 942 | WP_011285633.1 | LPXTG cell wall anchor domain-containing protein | - |
| H7X59_RS06180 (H7X59_06140) | recN | 1206046..1207707 (-) | 1662 | WP_010922485.1 | DNA repair protein RecN | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=474892 H7X59_RS05875 WP_011017964.1 1168881..1169063(-) (prx) [Streptococcus pyogenes strain SP1448]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=474892 H7X59_RS05875 WP_011017964.1 1168881..1169063(-) (prx) [Streptococcus pyogenes strain SP1448]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |