Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | H7X59_RS05040 | Genome accession | NZ_CP060267 |
| Coordinates | 1007141..1007329 (-) | Length | 62 a.a. |
| NCBI ID | WP_011285559.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain SP1448 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 999557..1045867 | 1007141..1007329 | within | 0 |
Gene organization within MGE regions
Location: 999557..1045867
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7X59_RS05005 (H7X59_04990) | pfkA | 999557..1000570 (-) | 1014 | WP_010922375.1 | 6-phosphofructokinase | - |
| H7X59_RS05010 (H7X59_04995) | - | 1000650..1003760 (-) | 3111 | WP_010922376.1 | DNA polymerase III subunit alpha | - |
| H7X59_RS05015 (H7X59_05000) | - | 1003945..1004316 (+) | 372 | WP_010922377.1 | GntR family transcriptional regulator | - |
| H7X59_RS05020 (H7X59_05005) | - | 1004316..1005014 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| H7X59_RS05025 (H7X59_05010) | - | 1005024..1005809 (+) | 786 | WP_010922378.1 | hypothetical protein | - |
| H7X59_RS05030 (H7X59_05015) | - | 1005936..1006550 (-) | 615 | WP_011285558.1 | TVP38/TMEM64 family protein | - |
| H7X59_RS05040 (H7X59_05025) | prx | 1007141..1007329 (-) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| H7X59_RS05045 (H7X59_05030) | speA | 1007549..1008304 (+) | 756 | WP_011285560.1 | streptococcal pyrogenic exotoxin SpeA | - |
| H7X59_RS05050 (H7X59_05035) | - | 1008426..1009085 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| H7X59_RS05055 (H7X59_05040) | - | 1009085..1009306 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| H7X59_RS05060 (H7X59_05045) | - | 1009316..1010089 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| H7X59_RS05065 (H7X59_05050) | - | 1010100..1010702 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| H7X59_RS05070 (H7X59_05055) | - | 1010714..1011478 (-) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| H7X59_RS05075 (H7X59_05060) | - | 1011480..1011812 (-) | 333 | WP_011285562.1 | phage holin | - |
| H7X59_RS05080 (H7X59_05065) | - | 1011812..1012135 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| H7X59_RS05085 | - | 1012149..1012271 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| H7X59_RS05090 (H7X59_05070) | - | 1012285..1012632 (-) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| H7X59_RS05095 (H7X59_05075) | - | 1012643..1014505 (-) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| H7X59_RS05100 (H7X59_05080) | - | 1014510..1017950 (-) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| H7X59_RS05105 (H7X59_05085) | - | 1017951..1019435 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| H7X59_RS05110 (H7X59_05090) | - | 1019436..1021241 (-) | 1806 | WP_011054802.1 | phage tail protein | - |
| H7X59_RS05115 (H7X59_05095) | - | 1021234..1021692 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| H7X59_RS05120 (H7X59_05100) | - | 1021665..1021982 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| H7X59_RS05125 (H7X59_05105) | - | 1021995..1022501 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| H7X59_RS05130 (H7X59_05110) | - | 1022513..1022923 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| H7X59_RS05135 (H7X59_05115) | - | 1022925..1023320 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| H7X59_RS05140 (H7X59_05120) | - | 1023317..1023628 (-) | 312 | WP_011285567.1 | hypothetical protein | - |
| H7X59_RS05145 (H7X59_05125) | - | 1023625..1023969 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| H7X59_RS05150 (H7X59_05130) | - | 1023983..1024276 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| H7X59_RS05155 (H7X59_05135) | - | 1024289..1025179 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| H7X59_RS05160 (H7X59_05140) | - | 1025198..1025767 (-) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| H7X59_RS05165 | - | 1025876..1026010 (-) | 135 | WP_015055956.1 | hypothetical protein | - |
| H7X59_RS05170 (H7X59_05145) | - | 1026012..1026281 (-) | 270 | WP_011285568.1 | hypothetical protein | - |
| H7X59_RS05175 (H7X59_05150) | - | 1026288..1027196 (-) | 909 | WP_011285569.1 | minor capsid protein | - |
| H7X59_RS05180 (H7X59_05155) | - | 1027165..1028490 (-) | 1326 | WP_011285570.1 | phage portal protein | - |
| H7X59_RS05185 (H7X59_05160) | - | 1028490..1029764 (-) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| H7X59_RS05190 (H7X59_05165) | - | 1029754..1030134 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| H7X59_RS05195 (H7X59_05170) | - | 1030744..1031178 (-) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| H7X59_RS05200 (H7X59_05175) | - | 1031464..1031730 (-) | 267 | WP_011018131.1 | hypothetical protein | - |
| H7X59_RS05205 (H7X59_05180) | - | 1031727..1032251 (-) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| H7X59_RS05210 (H7X59_05185) | - | 1032254..1032886 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| H7X59_RS05215 (H7X59_05190) | - | 1032888..1033172 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| H7X59_RS05220 (H7X59_05195) | - | 1033169..1033339 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| H7X59_RS05225 (H7X59_05200) | - | 1033336..1033572 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| H7X59_RS09245 | - | 1033572..1033817 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| H7X59_RS05230 (H7X59_05205) | - | 1033814..1034170 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| H7X59_RS05235 (H7X59_05210) | - | 1034167..1034607 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| H7X59_RS05240 (H7X59_05215) | - | 1034607..1034810 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| H7X59_RS05245 (H7X59_05220) | ssb | 1034816..1035241 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| H7X59_RS05250 (H7X59_05225) | - | 1035234..1035908 (-) | 675 | WP_011285576.1 | ERF family protein | - |
| H7X59_RS05255 (H7X59_05230) | - | 1035909..1036391 (-) | 483 | WP_011285577.1 | siphovirus Gp157 family protein | - |
| H7X59_RS05260 (H7X59_05235) | - | 1036413..1036667 (-) | 255 | WP_011285578.1 | hypothetical protein | - |
| H7X59_RS05265 (H7X59_05240) | - | 1036648..1037001 (-) | 354 | WP_011285579.1 | hypothetical protein | - |
| H7X59_RS05270 (H7X59_05245) | - | 1037142..1037924 (-) | 783 | WP_011285581.1 | ATP-binding protein | - |
| H7X59_RS05275 (H7X59_05250) | - | 1037911..1038741 (-) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| H7X59_RS05280 | - | 1038755..1038943 (-) | 189 | Protein_997 | XRE family transcriptional regulator | - |
| H7X59_RS05285 | - | 1039177..1039416 (+) | 240 | WP_227874181.1 | hypothetical protein | - |
| H7X59_RS05290 (H7X59_05260) | - | 1039547..1039756 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| H7X59_RS05295 (H7X59_05265) | - | 1039866..1040066 (-) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| H7X59_RS05300 (H7X59_05270) | - | 1040140..1040526 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| H7X59_RS05305 (H7X59_05275) | - | 1040515..1040724 (-) | 210 | WP_011284881.1 | hypothetical protein | - |
| H7X59_RS05310 (H7X59_05280) | - | 1040778..1041377 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| H7X59_RS05315 (H7X59_05285) | - | 1041407..1041565 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| H7X59_RS05320 (H7X59_05290) | - | 1041922..1042746 (+) | 825 | WP_011285584.1 | XRE family transcriptional regulator | - |
| H7X59_RS05325 (H7X59_05295) | - | 1042782..1043675 (+) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| H7X59_RS05330 (H7X59_05300) | - | 1043796..1044884 (+) | 1089 | WP_272157229.1 | site-specific integrase | - |
| H7X59_RS05335 (H7X59_05305) | - | 1045247..1045867 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7290.41 Da Isoelectric Point: 4.3313
>NTDB_id=474888 H7X59_RS05040 WP_011285559.1 1007141..1007329(-) (prx) [Streptococcus pyogenes strain SP1448]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=474888 H7X59_RS05040 WP_011285559.1 1007141..1007329(-) (prx) [Streptococcus pyogenes strain SP1448]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
95.161 |
0.952 |
| prx | Streptococcus pyogenes MGAS315 |
79.032 |
100 |
0.79 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
95.161 |
0.71 |
| prx | Streptococcus pyogenes MGAS315 |
69.492 |
95.161 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
66.129 |
0.548 |