Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | H7X60_RS05810 | Genome accession | NZ_CP060266 |
| Coordinates | 1162876..1163058 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain SP1450 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1162876..1196362 | 1162876..1163058 | within | 0 |
Gene organization within MGE regions
Location: 1162876..1196362
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7X60_RS05810 (H7X60_05775) | prx | 1162876..1163058 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| H7X60_RS05815 (H7X60_05780) | sda3 | 1163297..1164097 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| H7X60_RS05820 (H7X60_05785) | - | 1164368..1164802 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| H7X60_RS05825 (H7X60_05790) | - | 1164872..1166077 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| H7X60_RS05830 (H7X60_05795) | - | 1166193..1166420 (-) | 228 | WP_003058873.1 | phage holin | - |
| H7X60_RS05835 (H7X60_05800) | - | 1166417..1166692 (-) | 276 | WP_002987582.1 | DUF7365 family protein | - |
| H7X60_RS05840 (H7X60_05805) | - | 1166702..1167319 (-) | 618 | WP_011285613.1 | DUF1366 domain-containing protein | - |
| H7X60_RS05845 (H7X60_05810) | - | 1167316..1167753 (-) | 438 | WP_011285614.1 | DUF1617 family protein | - |
| H7X60_RS05850 (H7X60_05815) | - | 1167765..1169381 (-) | 1617 | WP_015446227.1 | gp58-like family protein | - |
| H7X60_RS09235 | - | 1169388..1169633 (-) | 246 | Protein_1126 | phage tail spike protein | - |
| H7X60_RS05855 (H7X60_05820) | - | 1169630..1170325 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| H7X60_RS05860 (H7X60_05825) | - | 1170322..1172679 (-) | 2358 | WP_010922453.1 | phage tail protein | - |
| H7X60_RS05865 (H7X60_05830) | - | 1172679..1173050 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| H7X60_RS05870 (H7X60_05835) | - | 1173065..1173328 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| H7X60_RS05875 (H7X60_05840) | - | 1173339..1173932 (-) | 594 | WP_010922456.1 | tail protein | - |
| H7X60_RS05880 (H7X60_05845) | - | 1173944..1174279 (-) | 336 | WP_011285616.1 | hypothetical protein | - |
| H7X60_RS05885 (H7X60_05850) | - | 1174280..1174516 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| H7X60_RS05890 (H7X60_05855) | - | 1174509..1174847 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| H7X60_RS05895 (H7X60_05860) | - | 1174807..1175229 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| H7X60_RS05900 (H7X60_05865) | - | 1175239..1175439 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| H7X60_RS05905 (H7X60_05870) | - | 1175439..1176350 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| H7X60_RS05910 (H7X60_05875) | - | 1176375..1176836 (-) | 462 | WP_011285618.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| H7X60_RS05915 (H7X60_05880) | - | 1176917..1178332 (-) | 1416 | WP_011285619.1 | terminase | - |
| H7X60_RS05920 (H7X60_05885) | - | 1178442..1178708 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| H7X60_RS05925 (H7X60_05890) | - | 1178701..1178880 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| H7X60_RS05930 (H7X60_05895) | - | 1178930..1179154 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| H7X60_RS05935 (H7X60_05900) | - | 1179160..1180653 (-) | 1494 | WP_015446231.1 | hypothetical protein | - |
| H7X60_RS05940 (H7X60_05905) | - | 1180646..1181914 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| H7X60_RS05945 (H7X60_05910) | - | 1181911..1182267 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| H7X60_RS05950 (H7X60_05915) | - | 1182416..1182760 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| H7X60_RS05955 (H7X60_05920) | - | 1182869..1183288 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| H7X60_RS05960 (H7X60_05925) | - | 1183556..1184191 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| H7X60_RS05965 (H7X60_05930) | - | 1184193..1184462 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| H7X60_RS05970 (H7X60_05935) | - | 1184546..1185058 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| H7X60_RS05975 (H7X60_05940) | - | 1185055..1185396 (-) | 342 | WP_002988364.1 | hypothetical protein | - |
| H7X60_RS05980 (H7X60_05945) | - | 1185574..1185741 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| H7X60_RS05985 (H7X60_05950) | - | 1185751..1186548 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| H7X60_RS05990 (H7X60_05955) | - | 1186545..1187474 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| H7X60_RS05995 (H7X60_05960) | - | 1187477..1187806 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| H7X60_RS06000 (H7X60_05965) | - | 1187862..1188068 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| H7X60_RS06005 (H7X60_05970) | - | 1188077..1188217 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| H7X60_RS06010 (H7X60_05975) | - | 1188214..1188447 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| H7X60_RS06015 (H7X60_05980) | - | 1188428..1188817 (-) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| H7X60_RS06020 | - | 1188962..1189201 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| H7X60_RS06025 (H7X60_05985) | - | 1189301..1189486 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| H7X60_RS06030 (H7X60_05990) | - | 1189488..1189799 (-) | 312 | WP_002990080.1 | hypothetical protein | - |
| H7X60_RS06035 (H7X60_05995) | - | 1189877..1190062 (-) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| H7X60_RS06040 (H7X60_06000) | - | 1190229..1190468 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| H7X60_RS06045 (H7X60_06005) | - | 1190610..1191416 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| H7X60_RS06050 (H7X60_06010) | - | 1191351..1191617 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| H7X60_RS06055 (H7X60_06015) | - | 1191649..1192365 (-) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| H7X60_RS06060 (H7X60_06020) | - | 1192377..1192568 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| H7X60_RS06065 (H7X60_06025) | - | 1193204..1193299 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| H7X60_RS06070 (H7X60_06030) | - | 1193722..1194069 (+) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| H7X60_RS06075 (H7X60_06035) | - | 1194073..1194453 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| H7X60_RS06080 (H7X60_06040) | - | 1194465..1194731 (+) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| H7X60_RS06085 (H7X60_06045) | - | 1194855..1195997 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| H7X60_RS06090 (H7X60_06050) | - | 1196087..1196362 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=474836 H7X60_RS05810 WP_011017964.1 1162876..1163058(-) (prx) [Streptococcus pyogenes strain SP1450]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=474836 H7X60_RS05810 WP_011017964.1 1162876..1163058(-) (prx) [Streptococcus pyogenes strain SP1450]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |