Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | H7X61_RS06150 | Genome accession | NZ_CP060265 |
| Coordinates | 1229879..1230061 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain SP1451 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1229879..1265078 | 1229879..1230061 | within | 0 |
Gene organization within MGE regions
Location: 1229879..1265078
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7X61_RS06150 (H7X61_06105) | prx | 1229879..1230061 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| H7X61_RS06155 (H7X61_06110) | sda3 | 1230300..1231100 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| H7X61_RS06160 (H7X61_06115) | - | 1231371..1231805 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| H7X61_RS06165 (H7X61_06120) | - | 1231875..1233080 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| H7X61_RS06170 (H7X61_06125) | - | 1233196..1233423 (-) | 228 | WP_003058873.1 | phage holin | - |
| H7X61_RS06175 (H7X61_06130) | - | 1233420..1233695 (-) | 276 | WP_002987582.1 | DUF7365 family protein | - |
| H7X61_RS06180 (H7X61_06135) | - | 1233705..1234322 (-) | 618 | WP_011285613.1 | DUF1366 domain-containing protein | - |
| H7X61_RS06185 (H7X61_06140) | - | 1234319..1234756 (-) | 438 | WP_011285614.1 | DUF1617 family protein | - |
| H7X61_RS06190 (H7X61_06145) | - | 1234768..1236636 (-) | 1869 | WP_011285615.1 | gp58-like family protein | - |
| H7X61_RS06195 (H7X61_06150) | - | 1236633..1237328 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| H7X61_RS06200 (H7X61_06155) | - | 1237325..1239682 (-) | 2358 | WP_010922453.1 | phage tail protein | - |
| H7X61_RS06205 (H7X61_06160) | - | 1239682..1240053 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| H7X61_RS06210 (H7X61_06165) | - | 1240068..1240331 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| H7X61_RS06215 (H7X61_06170) | - | 1240342..1240935 (-) | 594 | WP_010922456.1 | tail protein | - |
| H7X61_RS06220 (H7X61_06175) | - | 1240947..1241282 (-) | 336 | WP_011285616.1 | hypothetical protein | - |
| H7X61_RS06225 (H7X61_06180) | - | 1241283..1241519 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| H7X61_RS06230 (H7X61_06185) | - | 1241512..1241850 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| H7X61_RS06235 (H7X61_06190) | - | 1241810..1242232 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| H7X61_RS06240 (H7X61_06195) | - | 1242242..1242442 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| H7X61_RS06245 (H7X61_06200) | - | 1242442..1243353 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| H7X61_RS06250 (H7X61_06205) | - | 1243378..1243839 (-) | 462 | WP_011285618.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| H7X61_RS06255 (H7X61_06210) | - | 1243920..1245335 (-) | 1416 | WP_011285619.1 | terminase | - |
| H7X61_RS06260 (H7X61_06215) | - | 1245445..1245711 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| H7X61_RS06265 (H7X61_06220) | - | 1245704..1245883 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| H7X61_RS06270 (H7X61_06225) | - | 1245933..1246157 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| H7X61_RS06275 (H7X61_06230) | - | 1246163..1247656 (-) | 1494 | WP_015446231.1 | hypothetical protein | - |
| H7X61_RS06280 (H7X61_06235) | - | 1247649..1248917 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| H7X61_RS06285 (H7X61_06240) | - | 1248914..1249269 (-) | 356 | Protein_1200 | hypothetical protein | - |
| H7X61_RS06290 (H7X61_06245) | - | 1249418..1249762 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| H7X61_RS06295 (H7X61_06250) | - | 1249871..1250290 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| H7X61_RS06300 (H7X61_06255) | - | 1250558..1251193 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| H7X61_RS06305 (H7X61_06260) | - | 1251195..1251464 (-) | 270 | WP_049525058.1 | hypothetical protein | - |
| H7X61_RS06310 (H7X61_06265) | - | 1251548..1252060 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| H7X61_RS06315 (H7X61_06270) | - | 1252057..1252398 (-) | 342 | WP_002988364.1 | hypothetical protein | - |
| H7X61_RS06320 (H7X61_06275) | - | 1252576..1252743 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| H7X61_RS06325 (H7X61_06280) | - | 1252753..1253550 (-) | 798 | WP_272112143.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| H7X61_RS06330 (H7X61_06285) | - | 1253543..1253743 (-) | 201 | WP_000594115.1 | hypothetical protein | - |
| H7X61_RS06335 (H7X61_06290) | - | 1253740..1254666 (-) | 927 | WP_272112144.1 | recombinase RecT | - |
| H7X61_RS06340 (H7X61_06295) | - | 1254669..1254998 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| H7X61_RS06345 (H7X61_06300) | - | 1255054..1255260 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| H7X61_RS06350 (H7X61_06305) | - | 1255269..1255409 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| H7X61_RS06355 (H7X61_06310) | - | 1255406..1255639 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| H7X61_RS06360 (H7X61_06315) | - | 1255620..1256009 (-) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| H7X61_RS06365 | - | 1256154..1256393 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| H7X61_RS06370 (H7X61_06320) | - | 1256493..1256678 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| H7X61_RS06375 (H7X61_06325) | - | 1256680..1256991 (-) | 312 | WP_002990080.1 | hypothetical protein | - |
| H7X61_RS06380 (H7X61_06330) | - | 1257069..1257254 (-) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| H7X61_RS06385 (H7X61_06335) | - | 1257421..1257660 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| H7X61_RS06390 (H7X61_06340) | - | 1257802..1258608 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| H7X61_RS06395 (H7X61_06345) | - | 1258543..1258809 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| H7X61_RS06400 (H7X61_06350) | - | 1258841..1259557 (-) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| H7X61_RS06405 (H7X61_06355) | - | 1259569..1259760 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| H7X61_RS06410 (H7X61_06360) | - | 1260396..1260491 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| H7X61_RS06415 (H7X61_06365) | - | 1260914..1261261 (+) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| H7X61_RS06420 (H7X61_06370) | - | 1261265..1261645 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| H7X61_RS06425 (H7X61_06375) | - | 1261657..1261923 (+) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| H7X61_RS06430 (H7X61_06380) | - | 1262047..1263189 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| H7X61_RS06435 (H7X61_06385) | - | 1263279..1263554 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| H7X61_RS06440 (H7X61_06390) | - | 1263653..1264240 (-) | 588 | WP_010922482.1 | YpmS family protein | - |
| H7X61_RS06445 (H7X61_06395) | - | 1264218..1265060 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=474780 H7X61_RS06150 WP_011017964.1 1229879..1230061(-) (prx) [Streptococcus pyogenes strain SP1451]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=474780 H7X61_RS06150 WP_011017964.1 1229879..1230061(-) (prx) [Streptococcus pyogenes strain SP1451]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |