Detailed information NTG0474242

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: H6Y62_RS06690
• Genome accession: NZ_CP060160
• Coordinates: 1390777..1391091 (+)
• Length: 104 a.a.
• NCBI ID: WP_002459016.1
• Uniprot ID: -
• Organism: Staphylococcus lugdunensis strain MBAZ2
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1385777..1396091

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
H6Y62_RS06660 (H6Y62_06660)	-	1386569..1386772 (+)	204	WP_002459010.1	YqgQ family protein	-
H6Y62_RS06665 (H6Y62_06665)	-	1386769..1387755 (+)	987	WP_002491907.1	ROK family glucokinase	-
H6Y62_RS06670 (H6Y62_06670)	-	1387755..1388078 (+)	324	WP_002459012.1	MTH1187 family thiamine-binding protein	-
H6Y62_RS06675 (H6Y62_06675)	-	1388082..1388705 (+)	624	WP_002459013.1	MBL fold metallo-hydrolase	-
H6Y62_RS06680 (H6Y62_06680)	comGA	1388752..1389726 (+)	975	WP_037555185.1	competence type IV pilus ATPase ComGA	Machinery gene
H6Y62_RS06685 (H6Y62_06685)	comGB	1389698..1390762 (+)	1065	WP_002478130.1	competence type IV pilus assembly protein ComGB	-
H6Y62_RS06690 (H6Y62_06690)	comGC	1390777..1391091 (+)	315	WP_002459016.1	competence type IV pilus major pilin ComGC	Machinery gene
H6Y62_RS06695 (H6Y62_06695)	comGD	1391024..1391518 (+)	495	WP_225306455.1	competence type IV pilus minor pilin ComGD	-
H6Y62_RS06700 (H6Y62_06700)	-	1391505..1391798 (+)	294	WP_002459018.1	hypothetical protein	-
H6Y62_RS06705 (H6Y62_06705)	-	1391860..1392219 (+)	360	WP_002459019.1	competence type IV pilus minor pilin ComGF	-
H6Y62_RS06710 (H6Y62_06710)	-	1392373..1392891 (+)	519	WP_002459021.1	shikimate kinase	-
H6Y62_RS06715 (H6Y62_06715)	gcvT	1393061..1394152 (+)	1092	WP_037540763.1	glycine cleavage system aminomethyltransferase GcvT	-
H6Y62_RS06720 (H6Y62_06720)	gcvPA	1394169..1395518 (+)	1350	WP_002478134.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 104 a.a.
• Molecular weight: 11373.37 Da
• Isoelectric Point: 8.2727

>NTDB_id=474242 H6Y62_RS06690 WP_002459016.1 1390777..1391091(+) (comGC) [Staphylococcus lugdunensis strain MBAZ2]
MKFSFYKKCKAFTLIEMLLVLLIISVLLILIIPNIAKQTAHVQSTGCEAQVKMVNSQIEAYTLKHNGSPKSIDDLISEGF
IKDGQKNCKSGETISISNGEAVAN

Nucleotide

• Length: 315 bp

>NTDB_id=474242 H6Y62_RS06690 WP_002459016.1 1390777..1391091(+) (comGC) [Staphylococcus lugdunensis strain MBAZ2]
ATGAAATTTTCTTTTTATAAAAAATGCAAAGCGTTTACACTAATAGAAATGTTATTAGTATTACTAATTATTAGTGTCTT
GCTTATCTTAATTATTCCAAACATTGCCAAACAAACAGCACATGTACAATCAACAGGTTGTGAAGCACAAGTAAAGATGG
TCAATAGCCAAATAGAAGCCTATACTCTAAAGCATAATGGATCTCCAAAAAGCATTGATGATTTAATTTCTGAGGGTTTT
ATTAAAGATGGTCAAAAGAATTGCAAATCTGGGGAAACCATCAGCATATCAAATGGTGAGGCAGTTGCAAATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (7-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	82.353	98.077	0.808
comGC	Staphylococcus aureus N315	82.353	98.077	0.808
comYC	Streptococcus gordonii str. Challis substr. CH1	45.918	94.231	0.433
comGC/cglC	Streptococcus pneumoniae TIGR4	44.554	97.115	0.433
comGC	Bacillus subtilis subsp. subtilis str. 168	46.154	87.5	0.404
comGC/cglC	Streptococcus pneumoniae R6	48.235	81.731	0.394
comGC/cglC	Streptococcus pneumoniae Rx1	48.235	81.731	0.394
comGC/cglC	Streptococcus pneumoniae D39	48.235	81.731	0.394
comGC	Lactococcus lactis subsp. cremoris KW2	50.633	75.962	0.385
comGC/cglC	Streptococcus mitis SK321	51.282	75	0.385
comGC/cglC	Streptococcus mitis NCTC 12261	51.282	75	0.385
comYC	Streptococcus mutans UA140	48.75	76.923	0.375
comYC	Streptococcus mutans UA159	48.75	76.923	0.375