Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | SAA6159_RS10220 | Genome accession | NC_017338 |
| Coordinates | 2074212..2074682 (-) | Length | 156 a.a. |
| NCBI ID | WP_000934762.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus subsp. aureus JKD6159 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2043933..2094962 | 2074212..2074682 | within | 0 |
Gene organization within MGE regions
Location: 2043933..2094962
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SAA6159_RS09990 (SAA6159_01872) | scn | 2043933..2044283 (-) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| SAA6159_RS09995 (SAA6159_01873) | - | 2044968..2045417 (+) | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| SAA6159_RS10000 (SAA6159_01874) | - | 2045512..2045850 (-) | 339 | Protein_1934 | SH3 domain-containing protein | - |
| SAA6159_RS10005 (SAA6159_01875) | sak | 2046497..2046988 (-) | 492 | WP_000919350.1 | staphylokinase | - |
| SAA6159_RS10010 (SAA6159_01876) | - | 2047179..2047934 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| SAA6159_RS10015 (SAA6159_01877) | - | 2047946..2048200 (-) | 255 | WP_000611512.1 | phage holin | - |
| SAA6159_RS10020 (SAA6159_03495) | - | 2048252..2048359 (+) | 108 | WP_001791821.1 | hypothetical protein | - |
| SAA6159_RS10025 (SAA6159_01878) | pepG1 | 2048412..2048546 (-) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| SAA6159_RS10030 (SAA6159_01879) | - | 2048738..2049034 (-) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| SAA6159_RS10035 (SAA6159_01880) | - | 2049092..2049379 (-) | 288 | WP_001040261.1 | hypothetical protein | - |
| SAA6159_RS10040 (SAA6159_01881) | - | 2049426..2049578 (-) | 153 | WP_001153681.1 | hypothetical protein | - |
| SAA6159_RS10045 (SAA6159_01882) | - | 2049568..2053353 (-) | 3786 | WP_000582165.1 | phage tail spike protein | - |
| SAA6159_RS10050 (SAA6159_01883) | - | 2053369..2054853 (-) | 1485 | WP_000567408.1 | phage tail domain-containing protein | - |
| SAA6159_RS14065 | - | 2054850..2059361 (-) | 4512 | WP_000504560.1 | phage tail tape measure protein | - |
| SAA6159_RS10065 (SAA6159_01885) | gpGT | 2059418..2059555 (-) | 138 | WP_001549167.1 | phage tail assembly chaperone GT | - |
| SAA6159_RS10070 (SAA6159_01886) | gpG | 2059606..2059956 (-) | 351 | WP_001096355.1 | phage tail assembly chaperone G | - |
| SAA6159_RS10075 (SAA6159_03510) | - | 2060006..2060230 (-) | 225 | WP_071621395.1 | Ig-like domain-containing protein | - |
| SAA6159_RS10080 (SAA6159_01888) | - | 2060272..2060916 (-) | 645 | WP_000268733.1 | major tail protein | - |
| SAA6159_RS10085 (SAA6159_01889) | - | 2060917..2061324 (-) | 408 | WP_000565498.1 | hypothetical protein | - |
| SAA6159_RS10090 (SAA6159_01890) | - | 2061321..2061725 (-) | 405 | WP_000114227.1 | HK97 gp10 family phage protein | - |
| SAA6159_RS10095 (SAA6159_01891) | - | 2061722..2062084 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| SAA6159_RS10100 (SAA6159_01892) | - | 2062068..2062352 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| SAA6159_RS10105 (SAA6159_01893) | - | 2062342..2062626 (-) | 285 | WP_000238236.1 | hypothetical protein | - |
| SAA6159_RS10110 (SAA6159_01894) | - | 2062646..2063791 (-) | 1146 | WP_000154561.1 | phage major capsid protein | - |
| SAA6159_RS10115 (SAA6159_01895) | - | 2063815..2064552 (-) | 738 | WP_000861914.1 | head maturation protease, ClpP-related | - |
| SAA6159_RS10120 (SAA6159_01896) | - | 2064536..2065723 (-) | 1188 | WP_000025274.1 | phage portal protein | - |
| SAA6159_RS10125 (SAA6159_01897) | - | 2065739..2067400 (-) | 1662 | WP_000625088.1 | terminase large subunit | - |
| SAA6159_RS10130 (SAA6159_01898) | - | 2067397..2067741 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| SAA6159_RS10135 (SAA6159_01900) | - | 2067872..2068171 (-) | 300 | WP_000988330.1 | HNH endonuclease | - |
| SAA6159_RS10140 (SAA6159_01901) | - | 2068403..2068819 (-) | 417 | WP_000590122.1 | hypothetical protein | - |
| SAA6159_RS10145 (SAA6159_01902) | - | 2068847..2069047 (-) | 201 | WP_000265041.1 | DUF1514 family protein | - |
| SAA6159_RS10150 (SAA6159_01903) | - | 2069047..2069697 (-) | 651 | WP_001005262.1 | hypothetical protein | - |
| SAA6159_RS10155 (SAA6159_01905) | rinB | 2069856..2070005 (-) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| SAA6159_RS10160 (SAA6159_01906) | - | 2070002..2070208 (-) | 207 | WP_000195810.1 | DUF1381 domain-containing protein | - |
| SAA6159_RS10165 (SAA6159_01907) | - | 2070245..2070778 (-) | 534 | WP_001061836.1 | dUTP diphosphatase | - |
| SAA6159_RS10170 (SAA6159_01908) | - | 2070793..2070954 (-) | 162 | WP_000889683.1 | hypothetical protein | - |
| SAA6159_RS10175 (SAA6159_01909) | - | 2070955..2071236 (-) | 282 | WP_000454994.1 | hypothetical protein | - |
| SAA6159_RS10180 (SAA6159_01910) | - | 2071237..2071410 (-) | 174 | WP_000028424.1 | hypothetical protein | - |
| SAA6159_RS10185 (SAA6159_01911) | - | 2071400..2071651 (-) | 252 | WP_001065123.1 | DUF1024 family protein | - |
| SAA6159_RS10190 (SAA6159_01912) | - | 2071644..2071976 (-) | 333 | WP_078055840.1 | acetyltransferase | - |
| SAA6159_RS10195 (SAA6159_01913) | - | 2072024..2072266 (-) | 243 | WP_000131379.1 | phi PVL orf 51-like protein | - |
| SAA6159_RS10200 (SAA6159_01914) | - | 2072270..2072638 (-) | 369 | WP_000101275.1 | SA1788 family PVL leukocidin-associated protein | - |
| SAA6159_RS10205 (SAA6159_01915) | - | 2072651..2073055 (-) | 405 | WP_000401978.1 | RusA family crossover junction endodeoxyribonuclease | - |
| SAA6159_RS10210 (SAA6159_01916) | - | 2073064..2073282 (-) | 219 | WP_000338527.1 | hypothetical protein | - |
| SAA6159_RS10215 (SAA6159_01917) | - | 2073289..2074182 (-) | 894 | WP_000148328.1 | DnaD domain-containing protein | - |
| SAA6159_RS10220 (SAA6159_01918) | ssbA | 2074212..2074682 (-) | 471 | WP_000934762.1 | single-stranded DNA-binding protein | Machinery gene |
| SAA6159_RS10225 (SAA6159_01919) | - | 2074683..2075300 (-) | 618 | WP_072353921.1 | MBL fold metallo-hydrolase | - |
| SAA6159_RS10230 (SAA6159_01920) | - | 2075381..2076301 (-) | 921 | WP_000138475.1 | recombinase RecT | - |
| SAA6159_RS10235 (SAA6159_01921) | - | 2076303..2078258 (-) | 1956 | WP_048519603.1 | AAA family ATPase | - |
| SAA6159_RS10240 (SAA6159_03515) | - | 2078255..2078518 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| SAA6159_RS10245 (SAA6159_01922) | - | 2078527..2078787 (-) | 261 | WP_000291489.1 | DUF1108 family protein | - |
| SAA6159_RS10250 (SAA6159_01923) | - | 2078880..2079041 (-) | 162 | WP_000066020.1 | DUF1270 domain-containing protein | - |
| SAA6159_RS10255 (SAA6159_01924) | - | 2079038..2079358 (-) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| SAA6159_RS10260 (SAA6159_01925) | - | 2079417..2080049 (+) | 633 | WP_000275058.1 | hypothetical protein | - |
| SAA6159_RS10265 (SAA6159_01926) | - | 2080064..2080204 (-) | 141 | WP_000939496.1 | hypothetical protein | - |
| SAA6159_RS10270 (SAA6159_01927) | - | 2080235..2080429 (-) | 195 | WP_000388066.1 | hypothetical protein | - |
| SAA6159_RS10275 (SAA6159_01928) | - | 2080446..2081198 (-) | 753 | WP_001148618.1 | phage antirepressor KilAC domain-containing protein | - |
| SAA6159_RS10280 (SAA6159_01929) | - | 2081255..2081794 (+) | 540 | WP_000351243.1 | hypothetical protein | - |
| SAA6159_RS10285 (SAA6159_01930) | - | 2081818..2082078 (-) | 261 | WP_000435341.1 | transcriptional regulator | - |
| SAA6159_RS10290 (SAA6159_01931) | - | 2082091..2082330 (-) | 240 | WP_000548578.1 | helix-turn-helix transcriptional regulator | - |
| SAA6159_RS10295 (SAA6159_01932) | - | 2082501..2083208 (+) | 708 | WP_000094093.1 | XRE family transcriptional regulator | - |
| SAA6159_RS10300 (SAA6159_01933) | - | 2083220..2083375 (+) | 156 | WP_001049399.1 | hypothetical protein | - |
| SAA6159_RS10305 (SAA6159_01934) | - | 2083362..2083547 (+) | 186 | WP_001089804.1 | hypothetical protein | - |
| SAA6159_RS10310 (SAA6159_01935) | - | 2083747..2083914 (+) | 168 | WP_000705238.1 | hypothetical protein | - |
| SAA6159_RS10315 (SAA6159_01936) | - | 2084054..2084284 (+) | 231 | WP_000391617.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| SAA6159_RS10320 (SAA6159_01937) | - | 2084766..2085803 (+) | 1038 | WP_000857198.1 | site-specific integrase | - |
| SAA6159_RS10325 (SAA6159_01938) | sph | 2085860..2086684 (+) | 825 | Protein_1998 | sphingomyelin phosphodiesterase | - |
| SAA6159_RS10330 (SAA6159_01939) | lukG | 2086957..2087973 (-) | 1017 | WP_000595021.1 | bi-component leukocidin LukGH subunit G | - |
| SAA6159_RS10335 (SAA6159_01940) | lukH | 2087995..2089050 (-) | 1056 | WP_000791414.1 | bi-component leukocidin LukGH subunit H | - |
| SAA6159_RS10340 (SAA6159_01941) | - | 2089479..2090702 (+) | 1224 | WP_000206646.1 | ArgE/DapE family deacylase | - |
| SAA6159_RS10345 (SAA6159_01942) | - | 2091144..2092451 (+) | 1308 | WP_001045067.1 | TrkH family potassium uptake protein | - |
| SAA6159_RS10350 (SAA6159_01943) | groL | 2092987..2094603 (-) | 1617 | WP_000240650.1 | chaperonin GroEL | - |
| SAA6159_RS10355 (SAA6159_01944) | groES | 2094678..2094962 (-) | 285 | WP_000917290.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17673.58 Da Isoelectric Point: 5.2670
>NTDB_id=46356 SAA6159_RS10220 WP_000934762.1 2074212..2074682(-) (ssbA) [Staphylococcus aureus subsp. aureus JKD6159]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANCPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANCPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=46356 SAA6159_RS10220 WP_000934762.1 2074212..2074682(-) (ssbA) [Staphylococcus aureus subsp. aureus JKD6159]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTAAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATTGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTAAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATTGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.558 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Vibrio cholerae strain A1552 |
31.492 |
100 |
0.365 |
| ssb | Neisseria meningitidis MC58 |
32.948 |
100 |
0.365 |
| ssb | Neisseria gonorrhoeae MS11 |
32.948 |
100 |
0.365 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |