Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | HVV27_RS06240 | Genome accession | NZ_CP055246 |
| Coordinates | 1251670..1251852 (-) | Length | 60 a.a. |
| NCBI ID | WP_002986897.1 | Uniprot ID | A0A660A6E2 |
| Organism | Streptococcus pyogenes strain TSPY767 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1251670..1294177 | 1251670..1251852 | within | 0 |
Gene organization within MGE regions
Location: 1251670..1294177
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HVV27_RS06240 (HVV27_06240) | prx | 1251670..1251852 (-) | 183 | WP_002986897.1 | hypothetical protein | Regulator |
| HVV27_RS06245 (HVV27_06245) | - | 1252063..1252302 (+) | 240 | WP_002986898.1 | hypothetical protein | - |
| HVV27_RS06250 (HVV27_06250) | - | 1252342..1252815 (+) | 474 | WP_076634523.1 | hypothetical protein | - |
| HVV27_RS06255 (HVV27_06255) | - | 1252817..1253173 (+) | 357 | WP_003055891.1 | hypothetical protein | - |
| HVV27_RS06260 (HVV27_06260) | acrIIA3 | 1253306..1253680 (+) | 375 | WP_023611744.1 | anti-CRISPR protein AcrIIA3 | - |
| HVV27_RS06265 (HVV27_06265) | - | 1253680..1254282 (+) | 603 | WP_023611748.1 | AP endonuclease | - |
| HVV27_RS06270 (HVV27_06270) | - | 1254284..1254499 (+) | 216 | WP_023611751.1 | hypothetical protein | - |
| HVV27_RS06275 (HVV27_06275) | - | 1254568..1254807 (+) | 240 | WP_003055855.1 | hypothetical protein | - |
| HVV27_RS06280 (HVV27_06280) | - | 1254994..1256196 (-) | 1203 | WP_023611747.1 | glucosaminidase domain-containing protein | - |
| HVV27_RS06285 (HVV27_06285) | - | 1256312..1256539 (-) | 228 | WP_000609113.1 | phage holin | - |
| HVV27_RS06290 (HVV27_06290) | - | 1256536..1256811 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| HVV27_RS06295 (HVV27_06295) | - | 1256821..1257438 (-) | 618 | WP_032461328.1 | DUF1366 domain-containing protein | - |
| HVV27_RS06300 (HVV27_06300) | - | 1257441..1257872 (-) | 432 | WP_002987513.1 | DUF1617 family protein | - |
| HVV27_RS06305 (HVV27_06305) | - | 1257884..1259770 (-) | 1887 | WP_129820726.1 | gp58-like family protein | - |
| HVV27_RS06310 (HVV27_06310) | - | 1259781..1260095 (-) | 315 | WP_063812987.1 | hypothetical protein | - |
| HVV27_RS06315 (HVV27_06315) | - | 1260097..1261320 (-) | 1224 | WP_030127718.1 | hypothetical protein | - |
| HVV27_RS06320 (HVV27_06320) | - | 1261317..1263464 (-) | 2148 | WP_129820725.1 | phage tail spike protein | - |
| HVV27_RS06325 (HVV27_06325) | - | 1263461..1264177 (-) | 717 | WP_111711000.1 | distal tail protein Dit | - |
| HVV27_RS06330 (HVV27_06330) | - | 1264174..1267434 (-) | 3261 | WP_111711001.1 | tape measure protein | - |
| HVV27_RS06335 (HVV27_06335) | - | 1267424..1268005 (-) | 582 | WP_111711002.1 | bacteriophage Gp15 family protein | - |
| HVV27_RS06340 (HVV27_06340) | - | 1268009..1268443 (-) | 435 | WP_011888695.1 | hypothetical protein | - |
| HVV27_RS06345 (HVV27_06345) | - | 1268487..1268948 (-) | 462 | WP_011018120.1 | phage tail tube protein | - |
| HVV27_RS06350 (HVV27_06350) | - | 1268948..1269346 (-) | 399 | WP_011888694.1 | minor capsid protein | - |
| HVV27_RS06355 (HVV27_06355) | - | 1269343..1269699 (-) | 357 | WP_010922083.1 | minor capsid protein | - |
| HVV27_RS06360 (HVV27_06360) | - | 1269699..1270031 (-) | 333 | WP_111711003.1 | minor capsid protein | - |
| HVV27_RS06365 (HVV27_06365) | - | 1270021..1270437 (-) | 417 | WP_111706022.1 | hypothetical protein | - |
| HVV27_RS06370 (HVV27_06370) | - | 1270491..1271309 (-) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| HVV27_RS06375 (HVV27_06375) | - | 1271313..1271927 (-) | 615 | WP_011106689.1 | hypothetical protein | - |
| HVV27_RS06380 (HVV27_06380) | - | 1272053..1272319 (-) | 267 | WP_011054745.1 | hypothetical protein | - |
| HVV27_RS06385 (HVV27_06385) | - | 1272381..1272620 (-) | 240 | WP_002986829.1 | hypothetical protein | - |
| HVV27_RS06390 (HVV27_06390) | - | 1272592..1274070 (-) | 1479 | WP_011054746.1 | phage minor capsid protein | - |
| HVV27_RS06395 (HVV27_06395) | - | 1274075..1275577 (-) | 1503 | WP_002986832.1 | phage portal protein | - |
| HVV27_RS06400 (HVV27_06400) | - | 1275591..1276882 (-) | 1292 | Protein_1235 | PBSX family phage terminase large subunit | - |
| HVV27_RS06405 (HVV27_06405) | - | 1276885..1277358 (-) | 474 | WP_023612332.1 | hypothetical protein | - |
| HVV27_RS06410 (HVV27_06410) | - | 1277409..1277786 (-) | 378 | WP_002986841.1 | ASCH domain-containing protein | - |
| HVV27_RS06415 (HVV27_06415) | - | 1277847..1278323 (-) | 477 | WP_174132581.1 | GNAT family N-acetyltransferase | - |
| HVV27_RS06420 (HVV27_06420) | - | 1278239..1278916 (-) | 678 | WP_002986850.1 | ABC transporter ATP-binding protein | - |
| HVV27_RS06425 (HVV27_06425) | - | 1278895..1279413 (-) | 519 | WP_002986854.1 | ParB N-terminal domain-containing protein | - |
| HVV27_RS06430 (HVV27_06430) | - | 1279494..1279751 (+) | 258 | WP_011054748.1 | hypothetical protein | - |
| HVV27_RS06435 (HVV27_06435) | - | 1280326..1280763 (-) | 438 | WP_032460571.1 | DUF1492 domain-containing protein | - |
| HVV27_RS06440 (HVV27_06440) | - | 1281030..1281665 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| HVV27_RS06445 (HVV27_06445) | - | 1281667..1281951 (-) | 285 | WP_032460570.1 | hypothetical protein | - |
| HVV27_RS06450 (HVV27_06450) | - | 1281948..1282361 (-) | 414 | WP_032460569.1 | YopX family protein | - |
| HVV27_RS06455 (HVV27_06455) | - | 1282371..1282640 (-) | 270 | WP_002987593.1 | hypothetical protein | - |
| HVV27_RS06460 (HVV27_06460) | - | 1282637..1282921 (-) | 285 | WP_011017568.1 | DUF3310 domain-containing protein | - |
| HVV27_RS06465 (HVV27_06465) | - | 1282915..1283112 (-) | 198 | WP_011017567.1 | hypothetical protein | - |
| HVV27_RS06470 (HVV27_06470) | - | 1283099..1283611 (-) | 513 | WP_111695843.1 | hypothetical protein | - |
| HVV27_RS06475 (HVV27_06475) | - | 1283608..1283946 (-) | 339 | WP_002990067.1 | hypothetical protein | - |
| HVV27_RS06480 (HVV27_06480) | - | 1284123..1284290 (-) | 168 | WP_009880273.1 | hypothetical protein | - |
| HVV27_RS06485 (HVV27_06485) | - | 1284300..1285097 (-) | 798 | WP_219966493.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| HVV27_RS06490 (HVV27_06490) | - | 1285090..1285290 (-) | 201 | WP_000594115.1 | hypothetical protein | - |
| HVV27_RS06495 (HVV27_06495) | - | 1285287..1286213 (-) | 927 | WP_011054700.1 | recombinase RecT | - |
| HVV27_RS06500 (HVV27_06500) | - | 1286216..1286545 (-) | 330 | WP_032463369.1 | hypothetical protein | - |
| HVV27_RS06505 (HVV27_06505) | - | 1286601..1286807 (-) | 207 | WP_002988357.1 | hypothetical protein | - |
| HVV27_RS06510 (HVV27_06510) | - | 1286816..1286956 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| HVV27_RS06515 (HVV27_06515) | - | 1286962..1287174 (-) | 213 | WP_002986875.1 | hypothetical protein | - |
| HVV27_RS06520 (HVV27_06520) | - | 1287155..1287565 (-) | 411 | WP_172450154.1 | DnaD domain-containing protein | - |
| HVV27_RS09505 | - | 1287608..1287679 (+) | 72 | Protein_1260 | hypothetical protein | - |
| HVV27_RS06525 (HVV27_06525) | - | 1287717..1287974 (-) | 258 | WP_019418742.1 | hypothetical protein | - |
| HVV27_RS06530 (HVV27_06530) | - | 1288068..1288253 (-) | 186 | WP_002986881.1 | hypothetical protein | - |
| HVV27_RS06535 (HVV27_06535) | - | 1288282..1288539 (-) | 258 | WP_032463372.1 | hypothetical protein | - |
| HVV27_RS06540 (HVV27_06540) | - | 1288645..1288860 (+) | 216 | WP_023611028.1 | hypothetical protein | - |
| HVV27_RS06545 (HVV27_06545) | - | 1288834..1289082 (-) | 249 | WP_023611035.1 | hypothetical protein | - |
| HVV27_RS06550 (HVV27_06550) | - | 1289161..1289361 (+) | 201 | WP_002986887.1 | KTSC domain-containing protein | - |
| HVV27_RS06555 (HVV27_06555) | - | 1289358..1289507 (-) | 150 | WP_002986888.1 | hypothetical protein | - |
| HVV27_RS06560 (HVV27_06560) | - | 1289540..1290268 (-) | 729 | WP_002986890.1 | phage antirepressor KilAC domain-containing protein | - |
| HVV27_RS06565 (HVV27_06565) | - | 1290279..1290470 (-) | 192 | WP_002986891.1 | hypothetical protein | - |
| HVV27_RS06570 (HVV27_06570) | - | 1291105..1291200 (+) | 96 | WP_020837683.1 | type I toxin-antitoxin system Fst family toxin | - |
| HVV27_RS06575 (HVV27_06575) | - | 1291619..1291978 (+) | 360 | WP_011054768.1 | helix-turn-helix domain-containing protein | - |
| HVV27_RS06580 (HVV27_06580) | - | 1291992..1292372 (+) | 381 | WP_076634137.1 | ImmA/IrrE family metallo-endopeptidase | - |
| HVV27_RS06585 (HVV27_06585) | - | 1292383..1292904 (+) | 522 | WP_002986895.1 | hypothetical protein | - |
| HVV27_RS06590 (HVV27_06590) | - | 1293080..1294177 (+) | 1098 | WP_032463383.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6772.68 Da Isoelectric Point: 3.9286
>NTDB_id=457168 HVV27_RS06240 WP_002986897.1 1251670..1251852(-) (prx) [Streptococcus pyogenes strain TSPY767]
MLTYDEFKQAIDDGYIVGDTVAIVRKNGQIFDYVLPGEKVRPSEVVAEEIVEEVVVELDK
MLTYDEFKQAIDDGYIVGDTVAIVRKNGQIFDYVLPGEKVRPSEVVAEEIVEEVVVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=457168 HVV27_RS06240 WP_002986897.1 1251670..1251852(-) (prx) [Streptococcus pyogenes strain TSPY767]
ATGCTAACATACGACGAGTTTAAGCAAGCAATCGATGACGGATATATCGTAGGAGACACAGTAGCGATTGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGCGAAAAAGTCAGACCGTCGGAGGTTGTGGCTGAGGAAATAGTGGAAGAGG
TGGTGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAGTTTAAGCAAGCAATCGATGACGGATATATCGTAGGAGACACAGTAGCGATTGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGCGAAAAAGTCAGACCGTCGGAGGTTGTGGCTGAGGAAATAGTGGAAGAGG
TGGTGGTGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS315 |
81.667 |
100 |
0.817 |
| prx | Streptococcus pyogenes MGAS8232 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
68.333 |
0.567 |