Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | HVV27_RS05755 | Genome accession | NZ_CP055246 |
| Coordinates | 1166838..1167020 (-) | Length | 60 a.a. |
| NCBI ID | WP_011528776.1 | Uniprot ID | A0A660A5W9 |
| Organism | Streptococcus pyogenes strain TSPY767 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1166838..1195141 | 1166838..1167020 | within | 0 |
Gene organization within MGE regions
Location: 1166838..1195141
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HVV27_RS05755 (HVV27_05755) | prx | 1166838..1167020 (-) | 183 | WP_011528776.1 | hypothetical protein | Regulator |
| HVV27_RS05760 (HVV27_05760) | entC3 | 1167133..1167915 (-) | 783 | WP_002988472.1 | enterotoxin type C3 EntC3 | - |
| HVV27_RS05765 (HVV27_05765) | - | 1168163..1169287 (-) | 1125 | WP_002988467.1 | Fic family protein | - |
| HVV27_RS05770 (HVV27_05770) | - | 1169423..1170640 (-) | 1218 | WP_011528778.1 | peptidoglycan amidohydrolase family protein | - |
| HVV27_RS05775 (HVV27_05775) | - | 1170759..1170986 (-) | 228 | WP_003058873.1 | phage holin | - |
| HVV27_RS05780 (HVV27_05780) | - | 1170983..1171255 (-) | 273 | WP_011017397.1 | hypothetical protein | - |
| HVV27_RS05785 (HVV27_05785) | - | 1171267..1171899 (-) | 633 | WP_011528779.1 | hypothetical protein | - |
| HVV27_RS05790 (HVV27_05790) | - | 1171902..1172330 (-) | 429 | WP_011528780.1 | DUF1617 family protein | - |
| HVV27_RS05795 (HVV27_05795) | - | 1172339..1174120 (-) | 1782 | WP_011528781.1 | gp58-like family protein | - |
| HVV27_RS05800 (HVV27_05800) | hylP | 1174135..1175250 (-) | 1116 | WP_011528782.1 | hyaluronoglucosaminidase | - |
| HVV27_RS05805 (HVV27_05805) | - | 1175247..1177223 (-) | 1977 | WP_011528783.1 | phage tail spike protein | - |
| HVV27_RS05810 (HVV27_05810) | - | 1177205..1177900 (-) | 696 | WP_002992579.1 | hypothetical protein | - |
| HVV27_RS05815 (HVV27_05815) | - | 1177897..1180254 (-) | 2358 | WP_011528784.1 | hypothetical protein | - |
| HVV27_RS05820 (HVV27_05820) | - | 1180254..1180625 (-) | 372 | WP_011528785.1 | DUF5361 domain-containing protein | - |
| HVV27_RS05825 (HVV27_05825) | - | 1180640..1180903 (-) | 264 | WP_003047548.1 | hypothetical protein | - |
| HVV27_RS05830 (HVV27_05830) | - | 1180914..1181435 (-) | 522 | WP_372237178.1 | phage tail protein | - |
| HVV27_RS09500 (HVV27_05835) | - | 1181484..1181604 (-) | 121 | Protein_1122 | phage tail protein | - |
| HVV27_RS05840 (HVV27_05840) | - | 1181616..1181951 (-) | 336 | WP_011528787.1 | hypothetical protein | - |
| HVV27_RS05845 (HVV27_05845) | - | 1181952..1182188 (-) | 237 | WP_000032787.1 | hypothetical protein | - |
| HVV27_RS05850 (HVV27_05850) | - | 1182181..1182518 (-) | 338 | Protein_1125 | hypothetical protein | - |
| HVV27_RS05855 (HVV27_05855) | - | 1182478..1182900 (-) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| HVV27_RS05860 (HVV27_05860) | - | 1182910..1183110 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| HVV27_RS05865 (HVV27_05865) | - | 1183110..1184021 (-) | 912 | WP_011528788.1 | phage major capsid protein | - |
| HVV27_RS05870 (HVV27_05870) | - | 1184046..1184507 (-) | 462 | WP_010922462.1 | DUF4355 domain-containing protein | - |
| HVV27_RS05875 (HVV27_05875) | - | 1184587..1186002 (-) | 1416 | WP_021299324.1 | phage terminase large subunit-like protein | - |
| HVV27_RS05880 (HVV27_05880) | - | 1186084..1186320 (-) | 237 | Protein_1131 | hypothetical protein | - |
| HVV27_RS05885 (HVV27_05885) | - | 1186322..1186588 (-) | 267 | WP_011054745.1 | hypothetical protein | - |
| HVV27_RS05890 (HVV27_05890) | - | 1186640..1186864 (-) | 225 | WP_002994100.1 | hypothetical protein | - |
| HVV27_RS05895 (HVV27_05895) | - | 1186870..1188363 (-) | 1494 | WP_010922467.1 | hypothetical protein | - |
| HVV27_RS05900 (HVV27_05900) | - | 1188356..1189624 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| HVV27_RS05905 (HVV27_05905) | - | 1189621..1189977 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| HVV27_RS05910 (HVV27_05910) | - | 1190125..1190469 (-) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| HVV27_RS05915 (HVV27_05915) | - | 1190577..1190996 (-) | 420 | WP_011528791.1 | DUF1492 domain-containing protein | - |
| HVV27_RS05920 (HVV27_05920) | - | 1191175..1191502 (-) | 328 | Protein_1139 | recombinase RecT | - |
| HVV27_RS05925 (HVV27_05925) | - | 1191505..1191834 (-) | 330 | WP_011528796.1 | hypothetical protein | - |
| HVV27_RS05930 (HVV27_05930) | - | 1191890..1192096 (-) | 207 | WP_002988357.1 | hypothetical protein | - |
| HVV27_RS05935 (HVV27_05935) | - | 1192105..1192245 (-) | 141 | WP_002988354.1 | hypothetical protein | - |
| HVV27_RS05940 (HVV27_05940) | - | 1192242..1192476 (-) | 235 | Protein_1143 | hypothetical protein | - |
| HVV27_RS05945 (HVV27_05945) | - | 1192457..1192660 (-) | 204 | Protein_1144 | DNA replication protein | - |
| HVV27_RS05950 (HVV27_05950) | - | 1192657..1193253 (+) | 597 | Protein_1145 | tyrosine-type recombinase/integrase | - |
| HVV27_RS05955 (HVV27_05955) | - | 1193342..1193617 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| HVV27_RS05960 (HVV27_05960) | - | 1193716..1194303 (-) | 588 | WP_002989129.1 | YpmS family protein | - |
| HVV27_RS05965 (HVV27_05965) | - | 1194281..1195123 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6840.81 Da Isoelectric Point: 4.7023
>NTDB_id=457165 HVV27_RS05755 WP_011528776.1 1166838..1167020(-) (prx) [Streptococcus pyogenes strain TSPY767]
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=457165 HVV27_RS05755 WP_011528776.1 1166838..1167020(-) (prx) [Streptococcus pyogenes strain TSPY767]
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
81.395 |
71.667 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |