Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | HQ617_RS03350 | Genome accession | NZ_CP054055 |
| Coordinates | 603711..603899 (+) | Length | 62 a.a. |
| NCBI ID | WP_000027835.1 | Uniprot ID | A0AAV3JNT7 |
| Organism | Streptococcus agalactiae strain GBS47 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 594925..603669 | 603711..603899 | flank | 42 |
| IS/Tn | 602644..603255 | 603711..603899 | flank | 456 |
Gene organization within MGE regions
Location: 594925..603899
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HQ617_RS03310 (HQ617_03305) | - | 596304..596465 (-) | 162 | WP_000508795.1 | TM2 domain-containing protein | - |
| HQ617_RS03315 (HQ617_03310) | - | 597207..598484 (+) | 1278 | WP_000594360.1 | ABC transporter permease | - |
| HQ617_RS03320 (HQ617_03315) | - | 598494..599150 (+) | 657 | WP_000353149.1 | ABC transporter ATP-binding protein | - |
| HQ617_RS03325 (HQ617_03320) | - | 599150..600526 (+) | 1377 | WP_000594351.1 | ABC transporter permease | - |
| HQ617_RS03330 (HQ617_03325) | - | 600623..601276 (+) | 654 | WP_000699093.1 | response regulator transcription factor | - |
| HQ617_RS03335 (HQ617_03330) | - | 601273..602592 (+) | 1320 | WP_000734169.1 | HAMP domain-containing sensor histidine kinase | - |
| HQ617_RS03340 (HQ617_03335) | - | 602644..603291 (-) | 648 | Protein_576 | IS3 family transposase | - |
| HQ617_RS03345 (HQ617_03340) | - | 603469..603669 (+) | 201 | WP_000076708.1 | CsbD family protein | - |
| HQ617_RS03350 (HQ617_03345) | prx | 603711..603899 (+) | 189 | WP_000027835.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7180.25 Da Isoelectric Point: 4.7815
>NTDB_id=450424 HQ617_RS03350 WP_000027835.1 603711..603899(+) (prx) [Streptococcus agalactiae strain GBS47]
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
Nucleotide
Download Length: 189 bp
>NTDB_id=450424 HQ617_RS03350 WP_000027835.1 603711..603899(+) (prx) [Streptococcus agalactiae strain GBS47]
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
72.222 |
87.097 |
0.629 |
| prx | Streptococcus pyogenes MGAS8232 |
69.091 |
88.71 |
0.613 |
| prx | Streptococcus pyogenes MGAS315 |
66.667 |
87.097 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
64.516 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
61.818 |
88.71 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
74.359 |
62.903 |
0.468 |
| prx | Streptococcus pyogenes MGAS315 |
78.378 |
59.677 |
0.468 |