Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | MGAS1882_RS05355 | Genome accession | NC_017053 |
| Coordinates | 1099112..1099294 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes MGAS1882 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1099112..1144995 | 1099112..1099294 | within | 0 |
Gene organization within MGE regions
Location: 1099112..1144995
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MGAS1882_RS05355 (MGAS1882_1102) | prx | 1099112..1099294 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| MGAS1882_RS05365 (MGAS1882_1104) | - | 1099640..1100215 (-) | 576 | WP_011054727.1 | hypothetical protein | - |
| MGAS1882_RS05370 (MGAS1882_1106) | spek | 1100691..1101470 (-) | 780 | WP_011054728.1 | streptococcal pyrogenic exotoxin SpeK | - |
| MGAS1882_RS05375 (MGAS1882_1107) | - | 1101775..1102641 (-) | 867 | WP_011054729.1 | DUF334 domain-containing protein | - |
| MGAS1882_RS05380 (MGAS1882_1108) | - | 1102629..1103153 (-) | 525 | WP_011017840.1 | Panacea domain-containing protein | - |
| MGAS1882_RS05385 (MGAS1882_1109) | - | 1103293..1104501 (-) | 1209 | WP_014411848.1 | glucosaminidase domain-containing protein | - |
| MGAS1882_RS05395 (MGAS1882_1110) | - | 1104617..1104844 (-) | 228 | WP_003058873.1 | phage holin | - |
| MGAS1882_RS05400 (MGAS1882_1111) | - | 1104841..1105116 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| MGAS1882_RS05405 (MGAS1882_1112) | - | 1105126..1105764 (-) | 639 | WP_014411849.1 | hypothetical protein | - |
| MGAS1882_RS05410 (MGAS1882_1113) | - | 1105767..1106195 (-) | 429 | WP_014411850.1 | DUF1617 family protein | - |
| MGAS1882_RS05415 (MGAS1882_1114) | - | 1106207..1108093 (-) | 1887 | WP_014411851.1 | gp58-like family protein | - |
| MGAS1882_RS05420 (MGAS1882_1115) | hylP | 1108106..1109128 (-) | 1023 | WP_014411852.1 | hyaluronidase HylP | - |
| MGAS1882_RS05425 (MGAS1882_1116) | - | 1109125..1111269 (-) | 2145 | WP_014411853.1 | phage tail spike protein | - |
| MGAS1882_RS05430 (MGAS1882_1117) | - | 1111266..1111973 (-) | 708 | WP_014411854.1 | distal tail protein Dit | - |
| MGAS1882_RS05435 (MGAS1882_1118) | - | 1111973..1115896 (-) | 3924 | WP_014411855.1 | phage tail tape measure protein | - |
| MGAS1882_RS09270 (MGAS1882_1119) | - | 1115909..1116076 (-) | 168 | WP_014411856.1 | hypothetical protein | - |
| MGAS1882_RS05445 (MGAS1882_1120) | gpG | 1116106..1116432 (-) | 327 | WP_014411857.1 | phage tail assembly chaperone G | - |
| MGAS1882_RS05450 (MGAS1882_1121) | - | 1116485..1117093 (-) | 609 | WP_014411858.1 | major tail protein | - |
| MGAS1882_RS05455 (MGAS1882_1122) | - | 1117110..1117535 (-) | 426 | WP_002985347.1 | hypothetical protein | - |
| MGAS1882_RS05460 (MGAS1882_1123) | - | 1117532..1117909 (-) | 378 | WP_002985349.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| MGAS1882_RS05465 (MGAS1882_1124) | - | 1117906..1118253 (-) | 348 | WP_002985351.1 | phage head closure protein | - |
| MGAS1882_RS05470 (MGAS1882_1125) | - | 1118250..1118552 (-) | 303 | WP_014411860.1 | head-tail connector protein | - |
| MGAS1882_RS09275 (MGAS1882_1126) | - | 1118555..1118701 (-) | 147 | WP_023610896.1 | hypothetical protein | - |
| MGAS1882_RS05475 (MGAS1882_1127) | - | 1118688..1119890 (-) | 1203 | WP_014411862.1 | phage major capsid protein | - |
| MGAS1882_RS05480 (MGAS1882_1128) | - | 1119916..1120586 (-) | 671 | Protein_1045 | head maturation protease, ClpP-related | - |
| MGAS1882_RS05485 (MGAS1882_1129) | - | 1120564..1121784 (-) | 1221 | WP_014411863.1 | phage portal protein | - |
| MGAS1882_RS05490 (MGAS1882_1130) | - | 1121818..1122042 (-) | 225 | WP_002985363.1 | hypothetical protein | - |
| MGAS1882_RS09280 (MGAS1882_1131) | - | 1122035..1122205 (-) | 171 | WP_002985365.1 | hypothetical protein | - |
| MGAS1882_RS05495 (MGAS1882_1132) | - | 1122202..1123956 (-) | 1755 | WP_014411864.1 | terminase large subunit | - |
| MGAS1882_RS05500 (MGAS1882_1133) | - | 1123971..1124438 (-) | 468 | WP_002985371.1 | phage terminase small subunit P27 family | - |
| MGAS1882_RS05505 (MGAS1882_1134) | - | 1124609..1124947 (-) | 339 | WP_002985375.1 | HNH endonuclease | - |
| MGAS1882_RS05515 (MGAS1882_1136) | - | 1125532..1125972 (-) | 441 | WP_014411867.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| MGAS1882_RS05520 (MGAS1882_1137) | - | 1126248..1126619 (-) | 372 | WP_014411868.1 | hypothetical protein | - |
| MGAS1882_RS05525 (MGAS1882_1138) | - | 1126616..1127326 (-) | 711 | WP_014411869.1 | DUF1642 domain-containing protein | - |
| MGAS1882_RS05530 (MGAS1882_1139) | - | 1127329..1127961 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| MGAS1882_RS05535 (MGAS1882_1140) | - | 1127963..1128247 (-) | 285 | WP_014411870.1 | hypothetical protein | - |
| MGAS1882_RS05540 (MGAS1882_1141) | - | 1128244..1128648 (-) | 405 | WP_014411871.1 | YopX family protein | - |
| MGAS1882_RS05545 (MGAS1882_1142) | - | 1128658..1128927 (-) | 270 | WP_002987593.1 | hypothetical protein | - |
| MGAS1882_RS05550 (MGAS1882_1143) | - | 1128924..1129208 (-) | 285 | WP_014411872.1 | DUF3310 domain-containing protein | - |
| MGAS1882_RS09485 (MGAS1882_1144) | - | 1129202..1129442 (-) | 241 | Protein_1060 | hypothetical protein | - |
| MGAS1882_RS09215 (MGAS1882_1145) | - | 1129439..1129796 (-) | 358 | Protein_1061 | hypothetical protein | - |
| MGAS1882_RS05565 (MGAS1882_1146) | - | 1129780..1130100 (-) | 321 | WP_011054576.1 | VRR-NUC domain-containing protein | - |
| MGAS1882_RS05570 (MGAS1882_1147) | - | 1130097..1130510 (-) | 414 | WP_008087509.1 | hypothetical protein | - |
| MGAS1882_RS05575 (MGAS1882_1149) | - | 1130772..1132247 (-) | 1476 | WP_014411876.1 | DNA primase family protein | - |
| MGAS1882_RS05580 (MGAS1882_1150) | - | 1132237..1133049 (-) | 813 | WP_014411877.1 | bifunctional DNA primase/polymerase | - |
| MGAS1882_RS05585 (MGAS1882_1151) | - | 1133052..1133510 (-) | 459 | WP_011054580.1 | DUF669 domain-containing protein | - |
| MGAS1882_RS05590 (MGAS1882_1152) | - | 1133526..1134755 (-) | 1230 | WP_011528546.1 | DEAD/DEAH box helicase | - |
| MGAS1882_RS05595 (MGAS1882_1153) | - | 1134857..1135537 (-) | 681 | WP_014411878.1 | AAA family ATPase | - |
| MGAS1882_RS05600 (MGAS1882_1154) | - | 1135538..1136020 (-) | 483 | WP_011054820.1 | siphovirus Gp157 family protein | - |
| MGAS1882_RS05605 (MGAS1882_1155) | - | 1136168..1136482 (-) | 315 | WP_014411879.1 | helix-turn-helix domain-containing protein | - |
| MGAS1882_RS09440 (MGAS1882_1156) | - | 1136498..1136632 (-) | 135 | WP_012560975.1 | hypothetical protein | - |
| MGAS1882_RS05610 (MGAS1882_1157) | - | 1136634..1136945 (-) | 312 | WP_014411880.1 | hypothetical protein | - |
| MGAS1882_RS05615 (MGAS1882_1158) | - | 1137023..1137208 (-) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| MGAS1882_RS05620 (MGAS1882_1159) | - | 1137375..1137614 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| MGAS1882_RS05625 (MGAS1882_1160) | - | 1137765..1137974 (+) | 210 | WP_002984292.1 | hypothetical protein | - |
| MGAS1882_RS05635 (MGAS1882_1161) | - | 1138227..1139033 (+) | 807 | WP_041174345.1 | TIGR02391 family protein | - |
| MGAS1882_RS05640 (MGAS1882_1162) | - | 1139245..1139484 (-) | 240 | WP_014411882.1 | helix-turn-helix domain-containing protein | - |
| MGAS1882_RS05645 (MGAS1882_1163) | - | 1139578..1140177 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| MGAS1882_RS08950 (MGAS1882_1164) | - | 1140207..1140365 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| MGAS1882_RS05650 (MGAS1882_1165) | - | 1140738..1141526 (+) | 789 | WP_014411883.1 | S24 family peptidase | - |
| MGAS1882_RS05655 (MGAS1882_1166) | - | 1141536..1141841 (+) | 306 | WP_011106738.1 | membrane protein | - |
| MGAS1882_RS05660 (MGAS1882_1167) | - | 1141964..1143106 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| MGAS1882_RS05665 (MGAS1882_1168) | - | 1143196..1143471 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| MGAS1882_RS05670 (MGAS1882_1169) | - | 1143570..1144157 (-) | 588 | WP_010922482.1 | YpmS family protein | - |
| MGAS1882_RS05675 (MGAS1882_1170) | - | 1144135..1144977 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=44536 MGAS1882_RS05355 WP_011017964.1 1099112..1099294(-) (prx) [Streptococcus pyogenes MGAS1882]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=44536 MGAS1882_RS05355 WP_011017964.1 1099112..1099294(-) (prx) [Streptococcus pyogenes MGAS1882]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |