Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | HHM66_RS07800 | Genome accession | NZ_CP053074 |
| Coordinates | 1604732..1604914 (-) | Length | 60 a.a. |
| NCBI ID | WP_170078152.1 | Uniprot ID | - |
| Organism | Streptococcus dysgalactiae subsp. equisimilis strain TPCH-A88 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1601794..1653907 | 1604732..1604914 | within | 0 |
Gene organization within MGE regions
Location: 1601794..1653907
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HHM66_RS07790 (HHM66_07800) | - | 1601794..1602702 (-) | 909 | WP_015057971.1 | ATP-binding cassette domain-containing protein | - |
| HHM66_RS07795 (HHM66_07805) | rlmD | 1603183..1604541 (-) | 1359 | WP_012767355.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
| HHM66_RS07800 (HHM66_07810) | prx | 1604732..1604914 (-) | 183 | WP_170078152.1 | Paratox | Regulator |
| HHM66_RS10875 | - | 1605014..1605241 (+) | 228 | WP_206151250.1 | hypothetical protein | - |
| HHM66_RS07805 (HHM66_07815) | - | 1605390..1605599 (-) | 210 | WP_048327315.1 | helix-turn-helix transcriptional regulator | - |
| HHM66_RS07810 (HHM66_07820) | - | 1605753..1605899 (+) | 147 | WP_164406938.1 | hypothetical protein | - |
| HHM66_RS07815 (HHM66_07825) | - | 1606041..1606292 (+) | 252 | WP_048327312.1 | hypothetical protein | - |
| HHM66_RS07820 (HHM66_07830) | - | 1606437..1607189 (-) | 753 | WP_115261972.1 | CHAP domain-containing protein | - |
| HHM66_RS07825 (HHM66_07835) | - | 1607311..1607538 (-) | 228 | WP_003058873.1 | phage holin | - |
| HHM66_RS07830 (HHM66_07840) | - | 1607535..1607807 (-) | 273 | WP_003058867.1 | hypothetical protein | - |
| HHM66_RS07835 (HHM66_07845) | - | 1607819..1608430 (-) | 612 | WP_170172075.1 | DUF1366 domain-containing protein | - |
| HHM66_RS07840 (HHM66_07850) | - | 1608433..1608864 (-) | 432 | WP_155961741.1 | DUF1617 family protein | - |
| HHM66_RS07845 (HHM66_07855) | - | 1608878..1610770 (-) | 1893 | WP_170078151.1 | gp58-like family protein | - |
| HHM66_RS07850 (HHM66_07860) | - | 1610779..1611417 (-) | 639 | WP_170078150.1 | hypothetical protein | - |
| HHM66_RS07855 (HHM66_07865) | - | 1611417..1612250 (-) | 834 | WP_170078149.1 | collagen-like protein | - |
| HHM66_RS07860 (HHM66_07870) | - | 1612250..1614397 (-) | 2148 | WP_170078148.1 | phage tail spike protein | - |
| HHM66_RS07865 (HHM66_07875) | - | 1614394..1615110 (-) | 717 | WP_170078147.1 | phage tail protein | - |
| HHM66_RS07870 (HHM66_07880) | - | 1615110..1618367 (-) | 3258 | WP_170078146.1 | tape measure protein | - |
| HHM66_RS07875 (HHM66_07885) | - | 1618357..1618938 (-) | 582 | WP_065361216.1 | bacteriophage Gp15 family protein | - |
| HHM66_RS07880 (HHM66_07890) | - | 1618947..1619381 (-) | 435 | WP_030127689.1 | hypothetical protein | - |
| HHM66_RS07885 (HHM66_07895) | - | 1619427..1619912 (-) | 486 | WP_030127725.1 | hypothetical protein | - |
| HHM66_RS07890 (HHM66_07900) | - | 1619912..1620310 (-) | 399 | WP_030127726.1 | minor capsid protein | - |
| HHM66_RS07895 (HHM66_07905) | - | 1620307..1620663 (-) | 357 | WP_065361215.1 | minor capsid protein | - |
| HHM66_RS07900 (HHM66_07910) | - | 1620663..1620995 (-) | 333 | WP_030127753.1 | minor capsid protein | - |
| HHM66_RS07905 (HHM66_07915) | - | 1620985..1621401 (-) | 417 | WP_030127695.1 | hypothetical protein | - |
| HHM66_RS07910 (HHM66_07920) | - | 1621455..1622273 (-) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| HHM66_RS07915 (HHM66_07925) | - | 1622277..1622891 (-) | 615 | WP_030127694.1 | hypothetical protein | - |
| HHM66_RS07920 (HHM66_07930) | - | 1623102..1623371 (-) | 270 | WP_136019522.1 | hypothetical protein | - |
| HHM66_RS07925 (HHM66_07935) | - | 1623431..1623670 (-) | 240 | WP_030127692.1 | hypothetical protein | - |
| HHM66_RS07930 (HHM66_07940) | - | 1623642..1625120 (-) | 1479 | WP_030127691.1 | phage minor capsid protein | - |
| HHM66_RS07935 (HHM66_07945) | - | 1625125..1626627 (-) | 1503 | WP_076636814.1 | phage portal protein | - |
| HHM66_RS07940 (HHM66_07950) | - | 1626641..1627927 (-) | 1287 | WP_231872416.1 | PBSX family phage terminase large subunit | - |
| HHM66_RS07945 (HHM66_07955) | terS | 1627930..1628643 (-) | 714 | WP_030126039.1 | phage terminase small subunit | - |
| HHM66_RS07950 (HHM66_07960) | - | 1629172..1629609 (-) | 438 | WP_143935192.1 | DUF1492 domain-containing protein | - |
| HHM66_RS07955 (HHM66_07965) | - | 1629973..1630308 (-) | 336 | WP_152652371.1 | hypothetical protein | - |
| HHM66_RS07960 (HHM66_07970) | - | 1630367..1630726 (-) | 360 | WP_170078145.1 | DUF1642 domain-containing protein | - |
| HHM66_RS07965 (HHM66_07975) | - | 1630729..1631079 (-) | 351 | WP_227986246.1 | HNH endonuclease signature motif containing protein | - |
| HHM66_RS07970 (HHM66_07980) | - | 1631081..1631563 (-) | 483 | WP_170078144.1 | class I SAM-dependent methyltransferase | - |
| HHM66_RS07975 (HHM66_07985) | - | 1631565..1631792 (-) | 228 | WP_170172076.1 | hypothetical protein | - |
| HHM66_RS07980 (HHM66_07990) | - | 1631785..1631985 (-) | 201 | WP_155977159.1 | hypothetical protein | - |
| HHM66_RS07985 (HHM66_07995) | - | 1631972..1632202 (-) | 231 | WP_155977161.1 | hypothetical protein | - |
| HHM66_RS07990 (HHM66_08000) | - | 1632202..1632363 (-) | 162 | WP_155977163.1 | hypothetical protein | - |
| HHM66_RS07995 (HHM66_08005) | - | 1632360..1632542 (-) | 183 | WP_165746059.1 | hypothetical protein | - |
| HHM66_RS08000 (HHM66_08010) | - | 1632545..1632964 (-) | 420 | WP_165746060.1 | YopX family protein | - |
| HHM66_RS08005 (HHM66_08015) | - | 1632961..1633236 (-) | 276 | WP_165746061.1 | nucleotide modification associated domain-containing protein | - |
| HHM66_RS11085 | - | 1633233..1633481 (-) | 249 | WP_342365474.1 | hypothetical protein | - |
| HHM66_RS08010 (HHM66_08020) | - | 1633478..1633834 (-) | 357 | WP_170078142.1 | hypothetical protein | - |
| HHM66_RS08015 (HHM66_08025) | - | 1633831..1634271 (-) | 441 | WP_111681758.1 | RusA family crossover junction endodeoxyribonuclease | - |
| HHM66_RS08020 (HHM66_08030) | - | 1634271..1634477 (-) | 207 | WP_170078141.1 | hypothetical protein | - |
| HHM66_RS08025 (HHM66_08035) | ssbA | 1634489..1634911 (-) | 423 | WP_170078140.1 | single-stranded DNA-binding protein | Machinery gene |
| HHM66_RS08030 (HHM66_08040) | - | 1634904..1635578 (-) | 675 | WP_170078139.1 | ERF family protein | - |
| HHM66_RS08035 (HHM66_08045) | - | 1635579..1636061 (-) | 483 | WP_170078138.1 | siphovirus Gp157 family protein | - |
| HHM66_RS08040 (HHM66_08050) | - | 1636083..1636337 (-) | 255 | WP_170078137.1 | hypothetical protein | - |
| HHM66_RS08045 (HHM66_08055) | - | 1636324..1636674 (-) | 351 | WP_170078136.1 | hypothetical protein | - |
| HHM66_RS08050 (HHM66_08060) | - | 1636812..1637594 (-) | 783 | WP_126425998.1 | ATP-binding protein | - |
| HHM66_RS08055 (HHM66_08065) | - | 1637581..1638297 (-) | 717 | WP_159333941.1 | DnaD domain protein | - |
| HHM66_RS08060 (HHM66_08070) | - | 1638416..1638556 (-) | 141 | WP_021340647.1 | hypothetical protein | - |
| HHM66_RS08065 (HHM66_08075) | - | 1638587..1638841 (-) | 255 | WP_170078135.1 | hypothetical protein | - |
| HHM66_RS08070 (HHM66_08080) | - | 1638912..1639097 (-) | 186 | WP_021340658.1 | helix-turn-helix transcriptional regulator | - |
| HHM66_RS08075 (HHM66_08085) | - | 1639244..1639468 (+) | 225 | WP_048327839.1 | hypothetical protein | - |
| HHM66_RS08080 (HHM66_08090) | - | 1639668..1639811 (+) | 144 | WP_021341082.1 | hypothetical protein | - |
| HHM66_RS08085 (HHM66_08095) | - | 1639784..1639960 (-) | 177 | WP_170078134.1 | hypothetical protein | - |
| HHM66_RS08090 (HHM66_08100) | - | 1639973..1640698 (-) | 726 | WP_110408006.1 | phage antirepressor KilAC domain-containing protein | - |
| HHM66_RS08095 (HHM66_08105) | - | 1640731..1640919 (-) | 189 | WP_046176844.1 | helix-turn-helix transcriptional regulator | - |
| HHM66_RS08100 (HHM66_08110) | - | 1641014..1641745 (+) | 732 | WP_110408000.1 | hypothetical protein | - |
| HHM66_RS08105 (HHM66_08115) | - | 1641720..1641992 (-) | 273 | WP_110408001.1 | hypothetical protein | - |
| HHM66_RS08110 (HHM66_08120) | - | 1642027..1642185 (-) | 159 | WP_110408002.1 | hypothetical protein | - |
| HHM66_RS08115 (HHM66_08125) | - | 1642545..1643309 (+) | 765 | WP_110408003.1 | XRE family transcriptional regulator | - |
| HHM66_RS08120 (HHM66_08130) | - | 1643319..1643624 (+) | 306 | WP_111706070.1 | hypothetical protein | - |
| HHM66_RS08125 (HHM66_08135) | - | 1643800..1644966 (+) | 1167 | WP_170078133.1 | site-specific integrase | - |
| HHM66_RS08130 (HHM66_08140) | recX | 1645114..1645890 (+) | 777 | WP_170172077.1 | recombination regulator RecX | - |
| HHM66_RS08135 (HHM66_08145) | - | 1645972..1646505 (+) | 534 | WP_003061431.1 | DUF402 domain-containing protein | - |
| HHM66_RS08140 (HHM66_08150) | - | 1646559..1646870 (+) | 312 | WP_003053435.1 | DUF960 domain-containing protein | - |
| HHM66_RS10880 | - | 1652919..1653059 (-) | 141 | WP_015057314.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7056.06 Da Isoelectric Point: 4.0610
>NTDB_id=442788 HHM66_RS07800 WP_170078152.1 1604732..1604914(-) (prx) [Streptococcus dysgalactiae subsp. equisimilis strain TPCH-A88]
MLTYDEFKQAIDRGYITGDTVMIVRKNGQIFDYVLPNEEIKNGEVVIEERVEEVMMELDK
MLTYDEFKQAIDRGYITGDTVMIVRKNGQIFDYVLPNEEIKNGEVVIEERVEEVMMELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=442788 HHM66_RS07800 WP_170078152.1 1604732..1604914(-) (prx) [Streptococcus dysgalactiae subsp. equisimilis strain TPCH-A88]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGGAGATAAAGAATGGTGAAGTTGTGATAGAGGAGAGAGTGGAGGAGG
TGATGATGGAATTAGACAAATAA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGGAGATAAAGAATGGTGAAGTTGTGATAGAGGAGAGAGTGGAGGAGG
TGATGATGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS8232 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
88.372 |
71.667 |
0.633 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
70 |
0.5 |