Detailed information NTG0441461

Bioinformatically predicted

Overview

• Name: clpP
• Type: Regulator
• Locus tag: HHK01_RS14140
• Genome accession: NZ_CP052135
• Coordinates: 2880417..2881001 (-)
• Length: 194 a.a.
• NCBI ID: WP_170008821.1
• Uniprot ID: -
• Organism: Bacillus fonticola strain CS13
• Function: degradation of ComK; degradation of DegU (predicted from homology) Competence regulation

Genomic Context

Location: 2875417..2886001

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
HHK01_RS14110	-	2875699..2876568 (+)	870	WP_170008369.1	cation diffusion facilitator family transporter	-
HHK01_RS14115	spoIIR	2876625..2877287 (-)	663	WP_170008370.1	stage II sporulation protein R	-
HHK01_RS14120	-	2877351..2878265 (-)	915	WP_170008371.1	acetamidase/formamidase family protein	-
HHK01_RS14125	motA	2878509..2879297 (+)	789	WP_170008372.1	flagellar motor stator protein MotA	-
HHK01_RS14130	motB	2879290..2880054 (+)	765	WP_170008373.1	flagellar motor protein MotB	-
HHK01_RS15985	-	2880178..2880321 (+)	144	WP_407646965.1	DUF3977 family protein	-
HHK01_RS14140	clpP	2880417..2881001 (-)	585	WP_170008821.1	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	Regulator
HHK01_RS14145	-	2881022..2881735 (-)	714	WP_170008374.1	sigma-70 family RNA polymerase sigma factor	-
HHK01_RS14150	prmC	2882298..2883146 (-)	849	WP_170008375.1	peptide chain release factor N(5)-glutamine methyltransferase	-
HHK01_RS14155	prfA	2883147..2884223 (-)	1077	WP_170008376.1	peptide chain release factor 1	-
HHK01_RS14160	-	2884365..2884808 (-)	444	WP_170008377.1	hypothetical protein	-
HHK01_RS14165	-	2884895..2885515 (-)	621	WP_170008378.1	thymidine kinase	-
HHK01_RS14170	rpmE	2885686..2885886 (-)	201	WP_170008822.1	50S ribosomal protein L31	-

Sequence

Protein

• Length: 194 a.a.
• Molecular weight: 21523.50 Da
• Isoelectric Point: 5.0776

>NTDB_id=441461 HHK01_RS14140 WP_170008821.1 2880417..2881001(-) (clpP) [Bacillus fonticola strain CS13]
MTTIPYVIEQSSRGERSYDIYSRLLKDRIIMVGDEINDHMANSIVAQLLFLAADNPEKDITLYINSPGGSTSAGFAIFDT
MQYIEPDVRTVCTGFAASFGAMLLLAGGKGKRFALPNSEIMIHQPLGGARGQATEIEISARRILKLRERVNHIISERTGQ
PLEKVTTDSDRDYFMSAQEAKEYGIIDEIIQSSK

Nucleotide

• Length: 585 bp

>NTDB_id=441461 HHK01_RS14140 WP_170008821.1 2880417..2881001(-) (clpP) [Bacillus fonticola strain CS13]
ATGACTACAATTCCGTATGTGATTGAACAATCGAGCCGTGGAGAGCGTTCGTATGACATATATTCGCGACTGTTAAAAGA
CCGAATTATTATGGTTGGTGATGAAATTAACGACCACATGGCAAATTCCATTGTCGCGCAGCTGCTCTTTTTGGCTGCTG
ATAATCCAGAGAAAGACATCACCCTATATATTAACAGTCCAGGTGGATCGACATCTGCAGGTTTCGCTATTTTTGACACG
ATGCAATACATTGAACCTGATGTACGCACTGTTTGTACAGGATTTGCCGCTTCATTCGGTGCGATGCTATTGCTCGCTGG
GGGGAAGGGAAAGCGATTCGCACTCCCGAACAGTGAGATCATGATTCACCAACCATTAGGAGGGGCAAGAGGGCAAGCGA
CAGAGATCGAGATTTCCGCACGACGCATCCTGAAGCTCCGAGAACGAGTAAACCACATTATTTCAGAGCGAACGGGCCAA
CCGTTGGAGAAGGTGACTACAGACTCGGATCGCGATTACTTCATGAGCGCGCAGGAAGCAAAAGAGTATGGGATTATTGA
TGAGATTATTCAGTCTAGCAAATAA

Domains

Predicted by InterproScan.

• Clp protease (CLP_protease) (13-192)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
clpP	Bacillus subtilis subsp. subtilis str. 168	68.557	100	0.686
clpP	Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819	67.368	97.938	0.66
clpP	Streptococcus thermophilus LMG 18311	58.031	99.485	0.577
clpP	Streptococcus thermophilus LMD-9	58.031	99.485	0.577
clpP	Streptococcus pneumoniae D39	57.292	98.969	0.567
clpP	Streptococcus pneumoniae Rx1	57.292	98.969	0.567
clpP	Streptococcus pneumoniae R6	57.292	98.969	0.567
clpP	Streptococcus pneumoniae TIGR4	57.292	98.969	0.567
clpP	Lactococcus lactis subsp. cremoris KW2	55.729	98.969	0.552
clpP	Streptococcus pyogenes JRS4	54.404	99.485	0.541
clpP	Streptococcus pyogenes MGAS315	54.404	99.485	0.541
clpP	Streptococcus mutans UA159	53.846	100	0.541
clpP	Lactococcus lactis subsp. lactis strain DGCC12653	54.167	98.969	0.536