Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | HFV09_RS05140 | Genome accession | NZ_CP051138 |
| Coordinates | 1038068..1038256 (-) | Length | 62 a.a. |
| NCBI ID | WP_011528571.1 | Uniprot ID | A0A660A3N3 |
| Organism | Streptococcus pyogenes strain 4063-05 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1038068..1087878 | 1038068..1038256 | within | 0 |
Gene organization within MGE regions
Location: 1038068..1087878
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HFV09_RS05140 | prx | 1038068..1038256 (-) | 189 | WP_011528571.1 | hypothetical protein | Regulator |
| HFV09_RS05145 | sda3 | 1038494..1039294 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| HFV09_RS05150 | - | 1039566..1040000 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| HFV09_RS05155 | - | 1040069..1040728 (-) | 660 | WP_173948634.1 | hypothetical protein | - |
| HFV09_RS05160 | - | 1040728..1040949 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| HFV09_RS05165 | - | 1040959..1041732 (-) | 774 | WP_011528569.1 | hypothetical protein | - |
| HFV09_RS05170 | - | 1041743..1042345 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| HFV09_RS05175 | - | 1042357..1043121 (-) | 765 | WP_011054797.1 | CHAP domain-containing protein | - |
| HFV09_RS05180 | - | 1043123..1043455 (-) | 333 | WP_011054798.1 | phage holin | - |
| HFV09_RS05185 | - | 1043455..1043778 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| HFV09_RS09645 | - | 1043792..1043914 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| HFV09_RS05190 | - | 1043928..1044275 (-) | 348 | WP_009880247.1 | DUF1366 domain-containing protein | - |
| HFV09_RS05195 | - | 1044286..1046148 (-) | 1863 | WP_011528568.1 | DUF859 family phage minor structural protein | - |
| HFV09_RS05200 | - | 1046153..1049602 (-) | 3450 | WP_011528567.1 | glucosaminidase domain-containing protein | - |
| HFV09_RS05205 | - | 1049603..1051087 (-) | 1485 | WP_011528566.1 | distal tail protein Dit | - |
| HFV09_RS05210 | - | 1051088..1052893 (-) | 1806 | WP_011528565.1 | tail protein | - |
| HFV09_RS05215 | - | 1052886..1053344 (-) | 459 | WP_011528564.1 | hypothetical protein | - |
| HFV09_RS05220 | - | 1053317..1053634 (-) | 318 | WP_011528563.1 | hypothetical protein | - |
| HFV09_RS05225 | - | 1053647..1054153 (-) | 507 | WP_079890482.1 | phage major tail protein, TP901-1 family | - |
| HFV09_RS05230 | - | 1054165..1054575 (-) | 411 | WP_011528561.1 | DUF5072 family protein | - |
| HFV09_RS05235 | - | 1054577..1054972 (-) | 396 | WP_011528560.1 | hypothetical protein | - |
| HFV09_RS05240 | - | 1054969..1055280 (-) | 312 | WP_011528559.1 | hypothetical protein | - |
| HFV09_RS05245 | - | 1055277..1055621 (-) | 345 | WP_011528558.1 | hypothetical protein | - |
| HFV09_RS05250 | - | 1055635..1055928 (-) | 294 | WP_011528557.1 | HeH/LEM domain-containing protein | - |
| HFV09_RS05255 | - | 1055940..1056830 (-) | 891 | WP_011528556.1 | hypothetical protein | - |
| HFV09_RS05260 | - | 1056849..1057418 (-) | 570 | WP_021299309.1 | DUF4355 domain-containing protein | - |
| HFV09_RS05265 | - | 1057530..1057760 (-) | 231 | WP_011528554.1 | hypothetical protein | - |
| HFV09_RS05270 | - | 1057767..1058675 (-) | 909 | WP_011528553.1 | minor capsid protein | - |
| HFV09_RS05275 | - | 1058644..1059969 (-) | 1326 | WP_011528552.1 | phage portal protein | - |
| HFV09_RS05280 | - | 1059969..1061243 (-) | 1275 | WP_173948635.1 | PBSX family phage terminase large subunit | - |
| HFV09_RS05285 | - | 1061233..1061613 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| HFV09_RS05290 | - | 1061700..1061918 (+) | 219 | WP_011528550.1 | hypothetical protein | - |
| HFV09_RS05295 | - | 1062282..1062722 (-) | 441 | WP_011017866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| HFV09_RS05300 | - | 1062996..1063166 (-) | 171 | WP_164997036.1 | hypothetical protein | - |
| HFV09_RS05305 | - | 1063163..1063669 (-) | 507 | WP_011054751.1 | DUF1642 domain-containing protein | - |
| HFV09_RS05310 | - | 1063666..1063836 (-) | 171 | WP_011054752.1 | hypothetical protein | - |
| HFV09_RS05315 | - | 1063833..1064237 (-) | 405 | WP_011054753.1 | YopX family protein | - |
| HFV09_RS05320 | - | 1064247..1064516 (-) | 270 | WP_002987593.1 | hypothetical protein | - |
| HFV09_RS05325 | - | 1064513..1064797 (-) | 285 | WP_011017568.1 | DUF3310 domain-containing protein | - |
| HFV09_RS09715 | - | 1064791..1065042 (-) | 252 | WP_011528549.1 | hypothetical protein | - |
| HFV09_RS05330 | - | 1065039..1065395 (-) | 357 | WP_011018138.1 | hypothetical protein | - |
| HFV09_RS05335 | - | 1065379..1065699 (-) | 321 | WP_002995960.1 | VRR-NUC domain-containing protein | - |
| HFV09_RS05340 | - | 1065944..1067424 (-) | 1481 | Protein_998 | phage/plasmid primase, P4 family | - |
| HFV09_RS05345 | - | 1067414..1068226 (-) | 813 | WP_173948636.1 | bifunctional DNA primase/polymerase | - |
| HFV09_RS05350 | - | 1068229..1068687 (-) | 459 | WP_002995969.1 | DUF669 domain-containing protein | - |
| HFV09_RS05355 | - | 1068703..1069932 (-) | 1230 | WP_011528546.1 | DEAD/DEAH box helicase | - |
| HFV09_RS05360 | - | 1070034..1070714 (-) | 681 | WP_002995975.1 | AAA family ATPase | - |
| HFV09_RS05365 | - | 1070715..1071197 (-) | 483 | WP_011528545.1 | siphovirus Gp157 family protein | - |
| HFV09_RS05370 | - | 1071424..1071738 (-) | 315 | WP_011528544.1 | helix-turn-helix transcriptional regulator | - |
| HFV09_RS09650 | - | 1071754..1071888 (-) | 135 | WP_011528543.1 | hypothetical protein | - |
| HFV09_RS05375 | - | 1071919..1072170 (-) | 252 | WP_011528542.1 | AlpA family transcriptional regulator | - |
| HFV09_RS05380 | - | 1072265..1072483 (-) | 219 | WP_009881062.1 | helix-turn-helix domain-containing protein | - |
| HFV09_RS05385 | - | 1072672..1073031 (+) | 360 | WP_011528540.1 | helix-turn-helix transcriptional regulator | - |
| HFV09_RS05390 | - | 1073015..1073392 (+) | 378 | WP_011054824.1 | ImmA/IrrE family metallo-endopeptidase | - |
| HFV09_RS05395 | - | 1073403..1073555 (+) | 153 | WP_011054825.1 | hypothetical protein | - |
| HFV09_RS05400 | - | 1073726..1074412 (+) | 687 | WP_011528539.1 | hypothetical protein | - |
| HFV09_RS05405 | - | 1074534..1075673 (+) | 1140 | WP_011528538.1 | site-specific integrase | - |
| HFV09_RS05410 | rfbB | 1075756..1076796 (-) | 1041 | WP_002984881.1 | dTDP-glucose 4,6-dehydratase | - |
| HFV09_RS05415 | - | 1077040..1077633 (-) | 594 | WP_002990099.1 | dTDP-4-dehydrorhamnose 3,5-epimerase family protein | - |
| HFV09_RS05420 | rfbA | 1077633..1078502 (-) | 870 | WP_002992970.1 | glucose-1-phosphate thymidylyltransferase RfbA | - |
| HFV09_RS05425 | - | 1078560..1079666 (-) | 1107 | WP_011528537.1 | FAD-binding oxidoreductase | - |
| HFV09_RS05430 | - | 1079706..1080494 (-) | 789 | WP_021299315.1 | Nif3-like dinuclear metal center hexameric protein | - |
| HFV09_RS05435 | - | 1080484..1081170 (-) | 687 | WP_002990104.1 | tRNA (adenine(22)-N(1))-methyltransferase TrmK | - |
| HFV09_RS05440 | nth | 1081242..1081898 (-) | 657 | WP_002990106.1 | endonuclease III | - |
| HFV09_RS05445 | - | 1081895..1082578 (-) | 684 | WP_011184446.1 | DnaD domain-containing protein | - |
| HFV09_RS05450 | - | 1082659..1083177 (-) | 519 | WP_002990109.1 | adenine phosphoribosyltransferase | - |
| HFV09_RS05455 | recJ | 1083328..1085538 (-) | 2211 | WP_011528535.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| HFV09_RS05460 | - | 1085535..1086299 (-) | 765 | WP_021299305.1 | SDR family oxidoreductase | - |
| HFV09_RS05465 | rnz | 1086299..1087228 (-) | 930 | WP_009881223.1 | ribonuclease Z | - |
| HFV09_RS05470 | - | 1087243..1087878 (-) | 636 | WP_002990114.1 | cystathionine beta-lyase | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7224.11 Da Isoelectric Point: 4.0606
>NTDB_id=436169 HFV09_RS05140 WP_011528571.1 1038068..1038256(-) (prx) [Streptococcus pyogenes strain 4063-05]
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
Nucleotide
Download Length: 189 bp
>NTDB_id=436169 HFV09_RS05140 WP_011528571.1 1038068..1038256(-) (prx) [Streptococcus pyogenes strain 4063-05]
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
96.774 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
96.774 |
0.694 |
| prx | Streptococcus pyogenes MGAS315 |
90.698 |
69.355 |
0.629 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
66.129 |
0.565 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |