Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | HFV09_RS03390 | Genome accession | NZ_CP051138 |
| Coordinates | 658780..658962 (+) | Length | 60 a.a. |
| NCBI ID | WP_011528776.1 | Uniprot ID | A0A660A5W9 |
| Organism | Streptococcus pyogenes strain 4063-05 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 623297..658962 | 658780..658962 | within | 0 |
Gene organization within MGE regions
Location: 623297..658962
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HFV09_RS03125 | - | 623297..623572 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| HFV09_RS03130 | - | 623661..624803 (-) | 1143 | WP_003051793.1 | site-specific integrase | - |
| HFV09_RS03135 | - | 624927..625445 (-) | 519 | WP_011528799.1 | HIRAN domain-containing protein | - |
| HFV09_RS03140 | - | 625457..626212 (-) | 756 | WP_010922480.1 | XRE family transcriptional regulator | - |
| HFV09_RS03145 | - | 626414..626626 (+) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| HFV09_RS03150 | - | 626896..627207 (+) | 312 | WP_010922478.1 | excisionase | - |
| HFV09_RS03155 | - | 627209..627394 (+) | 186 | WP_010922477.1 | hypothetical protein | - |
| HFV09_RS09505 | - | 627488..627757 (+) | 270 | WP_011106700.1 | replication protein | - |
| HFV09_RS03160 | - | 627883..628269 (+) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| HFV09_RS03165 | - | 628250..628484 (+) | 235 | Protein_564 | hypothetical protein | - |
| HFV09_RS03170 | - | 628481..628621 (+) | 141 | WP_002988354.1 | hypothetical protein | - |
| HFV09_RS03175 | - | 628630..628836 (+) | 207 | WP_002988357.1 | hypothetical protein | - |
| HFV09_RS03180 | - | 628892..629220 (+) | 329 | Protein_567 | hypothetical protein | - |
| HFV09_RS03185 | - | 629223..630144 (+) | 922 | Protein_568 | recombinase RecT | - |
| HFV09_RS03190 | - | 630141..630341 (+) | 201 | WP_000594115.1 | hypothetical protein | - |
| HFV09_RS03195 | - | 630334..631131 (+) | 798 | WP_011054699.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| HFV09_RS03200 | - | 631496..631891 (+) | 396 | WP_011054698.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| HFV09_RS03205 | - | 631888..633234 (+) | 1347 | WP_011054697.1 | PcfJ domain-containing protein | - |
| HFV09_RS03210 | - | 633245..633577 (+) | 333 | WP_011184741.1 | hypothetical protein | - |
| HFV09_RS03215 | - | 633574..634086 (+) | 513 | WP_011054695.1 | hypothetical protein | - |
| HFV09_RS03220 | - | 634122..634439 (+) | 318 | WP_011054694.1 | DUF1372 family protein | - |
| HFV09_RS03225 | - | 634436..634591 (+) | 156 | WP_011054693.1 | hypothetical protein | - |
| HFV09_RS03230 | - | 634588..634839 (+) | 252 | WP_011054692.1 | hypothetical protein | - |
| HFV09_RS03235 | - | 634915..635334 (+) | 420 | WP_011528791.1 | DUF1492 domain-containing protein | - |
| HFV09_RS03240 | - | 635442..635786 (+) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| HFV09_RS03245 | - | 635934..636290 (+) | 357 | WP_002994106.1 | hypothetical protein | - |
| HFV09_RS03250 | - | 636287..637555 (+) | 1269 | WP_010922468.1 | phage portal protein | - |
| HFV09_RS03255 | - | 637548..639041 (+) | 1494 | WP_010922467.1 | hypothetical protein | - |
| HFV09_RS03260 | - | 639047..639271 (+) | 225 | WP_002994100.1 | hypothetical protein | - |
| HFV09_RS03265 | - | 639323..639589 (+) | 267 | WP_011054745.1 | hypothetical protein | - |
| HFV09_RS03270 | - | 639591..639827 (+) | 237 | Protein_585 | hypothetical protein | - |
| HFV09_RS03275 | - | 639909..641324 (+) | 1416 | WP_021299324.1 | phage terminase large subunit-like protein | - |
| HFV09_RS03280 | - | 641404..641865 (+) | 462 | WP_010922462.1 | DUF4355 domain-containing protein | - |
| HFV09_RS03285 | - | 641890..642801 (+) | 912 | WP_011528788.1 | phage major capsid protein | - |
| HFV09_RS03290 | - | 642801..643001 (+) | 201 | WP_010922460.1 | hypothetical protein | - |
| HFV09_RS03295 | - | 643011..643433 (+) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| HFV09_RS03300 | - | 643393..643731 (+) | 339 | WP_011054681.1 | hypothetical protein | - |
| HFV09_RS03305 | - | 643724..643960 (+) | 237 | WP_000032787.1 | hypothetical protein | - |
| HFV09_RS03310 | - | 643961..644296 (+) | 336 | WP_011528787.1 | hypothetical protein | - |
| HFV09_RS03315 | - | 644308..644886 (+) | 579 | WP_014635577.1 | hypothetical protein | - |
| HFV09_RS03320 | - | 644897..645160 (+) | 264 | WP_003047548.1 | hypothetical protein | - |
| HFV09_RS03325 | - | 645175..645546 (+) | 372 | WP_011528785.1 | DUF5361 domain-containing protein | - |
| HFV09_RS03330 | - | 645546..647903 (+) | 2358 | WP_011528784.1 | hypothetical protein | - |
| HFV09_RS03335 | - | 647900..648595 (+) | 696 | WP_002992579.1 | hypothetical protein | - |
| HFV09_RS03340 | - | 648577..650553 (+) | 1977 | WP_011528783.1 | phage tail spike protein | - |
| HFV09_RS03345 | hylP | 650550..651665 (+) | 1116 | WP_011528782.1 | hyaluronoglucosaminidase | - |
| HFV09_RS03350 | - | 651680..653461 (+) | 1782 | WP_011528781.1 | gp58-like family protein | - |
| HFV09_RS03355 | - | 653470..653898 (+) | 429 | WP_011528780.1 | DUF1617 family protein | - |
| HFV09_RS03360 | - | 653901..654533 (+) | 633 | WP_011528779.1 | hypothetical protein | - |
| HFV09_RS03365 | - | 654545..654817 (+) | 273 | WP_011017397.1 | hypothetical protein | - |
| HFV09_RS03370 | - | 654814..655041 (+) | 228 | WP_003058873.1 | phage holin | - |
| HFV09_RS03375 | - | 655160..656377 (+) | 1218 | WP_011528778.1 | peptidoglycan amidohydrolase family protein | - |
| HFV09_RS03380 | - | 656513..657637 (+) | 1125 | WP_002988467.1 | Fic family protein | - |
| HFV09_RS03385 | entC3 | 657885..658667 (+) | 783 | WP_002988472.1 | enterotoxin type C3 EntC3 | - |
| HFV09_RS03390 | prx | 658780..658962 (+) | 183 | WP_011528776.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6840.81 Da Isoelectric Point: 4.7023
>NTDB_id=436163 HFV09_RS03390 WP_011528776.1 658780..658962(+) (prx) [Streptococcus pyogenes strain 4063-05]
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=436163 HFV09_RS03390 WP_011528776.1 658780..658962(+) (prx) [Streptococcus pyogenes strain 4063-05]
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
81.395 |
71.667 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |