Detailed information NTG0431210

Bioinformatically predicted

Overview

• Name: comYD
• Type: Machinery gene
• Locus tag: HB751_RS08965
• Genome accession: NZ_CP050272
• Coordinates: 1835848..1836252 (+)
• Length: 134 a.a.
• NCBI ID: WP_002263438.1
• Uniprot ID: -
• Organism: Streptococcus mutans strain P6
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1830848..1841252

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
HB751_RS08945 (HB751_08945)	-	1833126..1833509 (+)	384	WP_002263434.1	DUF1033 family protein	-
HB751_RS08950 (HB751_08950)	comYA	1833639..1834580 (+)	942	WP_019804919.1	competence type IV pilus ATPase ComGA	Machinery gene
HB751_RS08955 (HB751_08955)	comYB	1834516..1835547 (+)	1032	WP_255262721.1	competence type IV pilus assembly protein ComGB	Machinery gene
HB751_RS08960 (HB751_08960)	comYC	1835547..1835861 (+)	315	WP_002263437.1	competence type IV pilus major pilin ComGC	Machinery gene
HB751_RS08965 (HB751_08965)	comYD	1835848..1836252 (+)	405	WP_002263438.1	competence type IV pilus minor pilin ComGD	Machinery gene
HB751_RS08970 (HB751_08970)	comYE	1836224..1836517 (+)	294	WP_002263439.1	competence type IV pilus minor pilin ComGE	Machinery gene
HB751_RS08975 (HB751_08975)	comYF	1836504..1836938 (+)	435	WP_002274770.1	competence type IV pilus minor pilin ComGF	Machinery gene
HB751_RS08980 (HB751_08980)	comYG	1836916..1837305 (+)	390	WP_002263441.1	competence type IV pilus minor pilin ComGG	Machinery gene
HB751_RS08985 (HB751_08985)	comYH	1837360..1838313 (+)	954	WP_019317550.1	class I SAM-dependent methyltransferase	Machinery gene
HB751_RS08990 (HB751_08990)	-	1838372..1839571 (+)	1200	WP_002263443.1	acetate kinase	-
HB751_RS08995 (HB751_08995)	tnpA	1839784..1840247 (+)	464	Protein_1739	IS200/IS605 family transposase	-
HB751_RS09000 (HB751_09000)	-	1840875..1841120 (+)	246	WP_002263444.1	helix-turn-helix transcriptional regulator	-

Sequence

Protein

• Length: 134 a.a.
• Molecular weight: 15444.77 Da
• Isoelectric Point: 9.5619

>NTDB_id=431210 HB751_RS08965 WP_002263438.1 1835848..1836252(+) (comYD) [Streptococcus mutans strain P6]
MSRIKAFTLIESLVTLAITSFLILSFSGSITQTFAKVEERLFFLSFEHLYRDTQKLSVYQRQDMTLILKSEYISNGVEVL
KIPKDVKLERNKTLHFDQAGGNSSLEKLVFQTSDEKRVTYQLYIGSGQYKKTES

Nucleotide

• Length: 405 bp

>NTDB_id=431210 HB751_RS08965 WP_002263438.1 1835848..1836252(+) (comYD) [Streptococcus mutans strain P6]
ATGTCGCGAATTAAAGCTTTTACGCTTATAGAAAGTTTAGTGACTTTGGCAATTACTAGTTTTTTGATTTTAAGCTTTTC
AGGTAGTATAACTCAAACGTTTGCCAAAGTAGAAGAGCGTCTCTTTTTTCTTTCTTTTGAACATCTTTACCGTGACACGC
AAAAACTTAGTGTTTATCAAAGACAAGATATGACTTTAATATTAAAAAGCGAATATATCTCAAATGGTGTTGAAGTACTT
AAAATCCCTAAGGATGTCAAACTAGAGAGGAATAAAACTTTGCACTTTGATCAGGCAGGAGGAAATTCTTCTTTAGAAAA
ACTTGTTTTTCAAACATCTGATGAAAAAAGAGTTACTTATCAATTATATATAGGAAGTGGTCAGTATAAAAAAACAGAAA
GTTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (1-25)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYD	Streptococcus mutans UA140	100	100	1
comYD	Streptococcus mutans UA159	100	100	1
comYD	Streptococcus gordonii str. Challis substr. CH1	50.388	96.269	0.485
comGD/cglD	Streptococcus mitis NCTC 12261	49.612	96.269	0.478
comGD/cglD	Streptococcus pneumoniae Rx1	49.219	95.522	0.47
comGD/cglD	Streptococcus pneumoniae D39	49.219	95.522	0.47
comGD/cglD	Streptococcus pneumoniae R6	49.219	95.522	0.47
comGD/cglD	Streptococcus pneumoniae TIGR4	48.438	95.522	0.463
comGD/cglD	Streptococcus mitis SK321	48.438	95.522	0.463
comGD	Lactococcus lactis subsp. cremoris KW2	39.394	98.507	0.388