Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | G9U50_RS03305 | Genome accession | NZ_CP049938 |
| Coordinates | 605508..605696 (+) | Length | 62 a.a. |
| NCBI ID | WP_000027835.1 | Uniprot ID | A0AAV3JNT7 |
| Organism | Streptococcus agalactiae strain ZQ0910 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 596318..605466 | 605508..605696 | flank | 42 |
| IS/Tn | 604462..605073 | 605508..605696 | flank | 435 |
Gene organization within MGE regions
Location: 596318..605696
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G9U50_RS03240 (G9U50_03240) | - | 596318..596584 (-) | 267 | WP_001872365.1 | hypothetical protein | - |
| G9U50_RS10390 | - | 596605..597967 (+) | 1363 | Protein_555 | IS3 family transposase | - |
| G9U50_RS03265 (G9U50_03265) | - | 598140..598301 (-) | 162 | WP_000508795.1 | NINE protein | - |
| G9U50_RS03270 (G9U50_03270) | - | 599043..600320 (+) | 1278 | WP_000594368.1 | ABC transporter permease | - |
| G9U50_RS03275 (G9U50_03275) | - | 600330..600986 (+) | 657 | WP_000353149.1 | ABC transporter ATP-binding protein | - |
| G9U50_RS03280 (G9U50_03280) | - | 600986..602362 (+) | 1377 | WP_000594351.1 | FtsX-like permease family protein | - |
| G9U50_RS03285 (G9U50_03285) | - | 602459..603112 (+) | 654 | WP_000699093.1 | response regulator transcription factor | - |
| G9U50_RS03290 (G9U50_03290) | - | 603109..604410 (+) | 1302 | WP_000734168.1 | HAMP domain-containing sensor histidine kinase | - |
| G9U50_RS03295 (G9U50_03295) | - | 604462..605109 (-) | 648 | Protein_562 | IS3 family transposase | - |
| G9U50_RS03300 (G9U50_03300) | - | 605287..605466 (+) | 180 | WP_000076709.1 | CsbD family protein | - |
| G9U50_RS03305 (G9U50_03305) | prx | 605508..605696 (+) | 189 | WP_000027835.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7180.25 Da Isoelectric Point: 4.7815
>NTDB_id=428833 G9U50_RS03305 WP_000027835.1 605508..605696(+) (prx) [Streptococcus agalactiae strain ZQ0910]
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
Nucleotide
Download Length: 189 bp
>NTDB_id=428833 G9U50_RS03305 WP_000027835.1 605508..605696(+) (prx) [Streptococcus agalactiae strain ZQ0910]
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
72.222 |
87.097 |
0.629 |
| prx | Streptococcus pyogenes MGAS8232 |
69.091 |
88.71 |
0.613 |
| prx | Streptococcus pyogenes MGAS315 |
66.667 |
87.097 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
64.516 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
61.818 |
88.71 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
74.359 |
62.903 |
0.468 |
| prx | Streptococcus pyogenes MGAS315 |
78.378 |
59.677 |
0.468 |