Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | G8B35_RS05155 | Genome accession | NZ_CP049697 |
| Coordinates | 1038248..1038436 (-) | Length | 62 a.a. |
| NCBI ID | WP_011528571.1 | Uniprot ID | A0A660A3N3 |
| Organism | Streptococcus pyogenes strain ABC3 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1038248..1088058 | 1038248..1038436 | within | 0 |
Gene organization within MGE regions
Location: 1038248..1088058
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G8B35_RS05155 (G8B35_05170) | prx | 1038248..1038436 (-) | 189 | WP_011528571.1 | hypothetical protein | Regulator |
| G8B35_RS05160 (G8B35_05175) | sda3 | 1038674..1039474 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| G8B35_RS05165 (G8B35_05180) | - | 1039746..1040180 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| G8B35_RS05170 (G8B35_05185) | - | 1040249..1040908 (-) | 660 | WP_011528570.1 | hypothetical protein | - |
| G8B35_RS05175 (G8B35_05190) | - | 1040908..1041129 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| G8B35_RS05180 (G8B35_05195) | - | 1041139..1041912 (-) | 774 | WP_011528569.1 | hypothetical protein | - |
| G8B35_RS05185 (G8B35_05200) | - | 1041923..1042525 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| G8B35_RS05190 (G8B35_05205) | - | 1042537..1043301 (-) | 765 | WP_011054797.1 | CHAP domain-containing protein | - |
| G8B35_RS05195 (G8B35_05210) | - | 1043303..1043635 (-) | 333 | WP_011054798.1 | phage holin | - |
| G8B35_RS05200 (G8B35_05215) | - | 1043635..1043958 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| G8B35_RS09525 | - | 1043972..1044094 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| G8B35_RS05205 (G8B35_05220) | - | 1044108..1044455 (-) | 348 | WP_009880247.1 | DUF1366 domain-containing protein | - |
| G8B35_RS05210 (G8B35_05225) | - | 1044466..1046328 (-) | 1863 | WP_011528568.1 | DUF859 family phage minor structural protein | - |
| G8B35_RS05215 (G8B35_05230) | - | 1046333..1049782 (-) | 3450 | WP_011528567.1 | glucosaminidase domain-containing protein | - |
| G8B35_RS05220 (G8B35_05235) | - | 1049783..1051267 (-) | 1485 | WP_011528566.1 | distal tail protein Dit | - |
| G8B35_RS05225 (G8B35_05240) | - | 1051268..1053073 (-) | 1806 | WP_011528565.1 | tail protein | - |
| G8B35_RS05230 (G8B35_05245) | - | 1053066..1053524 (-) | 459 | WP_011528564.1 | hypothetical protein | - |
| G8B35_RS05235 (G8B35_05250) | - | 1053497..1053814 (-) | 318 | WP_011528563.1 | hypothetical protein | - |
| G8B35_RS05240 (G8B35_05255) | - | 1053827..1054333 (-) | 507 | WP_079890482.1 | phage major tail protein, TP901-1 family | - |
| G8B35_RS05245 (G8B35_05260) | - | 1054345..1054755 (-) | 411 | WP_011528561.1 | DUF5072 family protein | - |
| G8B35_RS05250 (G8B35_05265) | - | 1054757..1055152 (-) | 396 | WP_011528560.1 | hypothetical protein | - |
| G8B35_RS05255 (G8B35_05270) | - | 1055149..1055460 (-) | 312 | WP_011528559.1 | hypothetical protein | - |
| G8B35_RS05260 (G8B35_05275) | - | 1055457..1055801 (-) | 345 | WP_011528558.1 | hypothetical protein | - |
| G8B35_RS05265 (G8B35_05280) | - | 1055815..1056108 (-) | 294 | WP_011528557.1 | HeH/LEM domain-containing protein | - |
| G8B35_RS05270 (G8B35_05285) | - | 1056120..1057010 (-) | 891 | WP_011528556.1 | hypothetical protein | - |
| G8B35_RS05275 (G8B35_05290) | - | 1057029..1057598 (-) | 570 | WP_021299309.1 | DUF4355 domain-containing protein | - |
| G8B35_RS05280 (G8B35_05295) | - | 1057710..1057940 (-) | 231 | WP_011528554.1 | hypothetical protein | - |
| G8B35_RS05285 (G8B35_05300) | - | 1057947..1058855 (-) | 909 | WP_011528553.1 | minor capsid protein | - |
| G8B35_RS05290 (G8B35_05305) | - | 1058824..1060149 (-) | 1326 | WP_011528552.1 | phage portal protein | - |
| G8B35_RS05295 (G8B35_05310) | - | 1060149..1061423 (-) | 1275 | WP_021299302.1 | PBSX family phage terminase large subunit | - |
| G8B35_RS05300 (G8B35_05315) | - | 1061413..1061793 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| G8B35_RS05305 (G8B35_05320) | - | 1061880..1062098 (+) | 219 | WP_011528550.1 | hypothetical protein | - |
| G8B35_RS05310 (G8B35_05325) | - | 1062462..1062902 (-) | 441 | WP_011017866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| G8B35_RS05315 (G8B35_05330) | - | 1063176..1063346 (-) | 171 | WP_164997036.1 | hypothetical protein | - |
| G8B35_RS05320 (G8B35_05335) | - | 1063343..1063849 (-) | 507 | WP_011054751.1 | DUF1642 domain-containing protein | - |
| G8B35_RS05325 (G8B35_05340) | - | 1063846..1064016 (-) | 171 | WP_011054752.1 | hypothetical protein | - |
| G8B35_RS05330 (G8B35_05345) | - | 1064013..1064417 (-) | 405 | WP_011054753.1 | YopX family protein | - |
| G8B35_RS05335 (G8B35_05350) | - | 1064427..1064696 (-) | 270 | WP_002987593.1 | hypothetical protein | - |
| G8B35_RS05340 (G8B35_05355) | - | 1064693..1064977 (-) | 285 | WP_011017568.1 | DUF3310 domain-containing protein | - |
| G8B35_RS09655 | - | 1064971..1065222 (-) | 252 | WP_011528549.1 | hypothetical protein | - |
| G8B35_RS05345 (G8B35_05360) | - | 1065219..1065575 (-) | 357 | WP_011018138.1 | hypothetical protein | - |
| G8B35_RS05350 (G8B35_05365) | - | 1065559..1065879 (-) | 321 | WP_002995960.1 | VRR-NUC domain-containing protein | - |
| G8B35_RS05355 (G8B35_05370) | - | 1066124..1067604 (-) | 1481 | Protein_1000 | phage/plasmid primase, P4 family | - |
| G8B35_RS05360 (G8B35_05375) | - | 1067594..1068406 (-) | 813 | WP_011528547.1 | bifunctional DNA primase/polymerase | - |
| G8B35_RS05365 (G8B35_05380) | - | 1068409..1068867 (-) | 459 | WP_002995969.1 | DUF669 domain-containing protein | - |
| G8B35_RS05370 (G8B35_05385) | - | 1068883..1070112 (-) | 1230 | WP_011528546.1 | DEAD/DEAH box helicase | - |
| G8B35_RS05375 (G8B35_05390) | - | 1070214..1070894 (-) | 681 | WP_002995975.1 | AAA family ATPase | - |
| G8B35_RS05380 (G8B35_05395) | - | 1070895..1071377 (-) | 483 | WP_011528545.1 | siphovirus Gp157 family protein | - |
| G8B35_RS05385 (G8B35_05400) | - | 1071604..1071918 (-) | 315 | WP_011528544.1 | helix-turn-helix transcriptional regulator | - |
| G8B35_RS09535 | - | 1071934..1072068 (-) | 135 | WP_011528543.1 | hypothetical protein | - |
| G8B35_RS05390 (G8B35_05405) | - | 1072099..1072350 (-) | 252 | WP_011528542.1 | AlpA family transcriptional regulator | - |
| G8B35_RS05395 (G8B35_05410) | - | 1072445..1072663 (-) | 219 | WP_009881062.1 | helix-turn-helix domain-containing protein | - |
| G8B35_RS05400 (G8B35_05415) | - | 1072852..1073211 (+) | 360 | WP_011528540.1 | helix-turn-helix transcriptional regulator | - |
| G8B35_RS05405 (G8B35_05420) | - | 1073195..1073572 (+) | 378 | WP_011054824.1 | ImmA/IrrE family metallo-endopeptidase | - |
| G8B35_RS05410 (G8B35_05425) | - | 1073583..1073735 (+) | 153 | WP_011054825.1 | hypothetical protein | - |
| G8B35_RS05415 (G8B35_05430) | - | 1073906..1074592 (+) | 687 | WP_011528539.1 | hypothetical protein | - |
| G8B35_RS05420 (G8B35_05435) | - | 1074714..1075853 (+) | 1140 | WP_011528538.1 | site-specific integrase | - |
| G8B35_RS05425 (G8B35_05440) | rfbB | 1075936..1076976 (-) | 1041 | WP_002984881.1 | dTDP-glucose 4,6-dehydratase | - |
| G8B35_RS05430 (G8B35_05445) | - | 1077220..1077813 (-) | 594 | WP_002990099.1 | dTDP-4-dehydrorhamnose 3,5-epimerase family protein | - |
| G8B35_RS05435 (G8B35_05450) | rfbA | 1077813..1078682 (-) | 870 | WP_002992970.1 | glucose-1-phosphate thymidylyltransferase RfbA | - |
| G8B35_RS05440 (G8B35_05455) | - | 1078740..1079846 (-) | 1107 | WP_011528537.1 | FAD-binding oxidoreductase | - |
| G8B35_RS05445 (G8B35_05460) | - | 1079886..1080674 (-) | 789 | WP_021299315.1 | Nif3-like dinuclear metal center hexameric protein | - |
| G8B35_RS05450 (G8B35_05465) | - | 1080664..1081350 (-) | 687 | WP_002990104.1 | tRNA (adenine(22)-N(1))-methyltransferase TrmK | - |
| G8B35_RS05455 (G8B35_05470) | nth | 1081422..1082078 (-) | 657 | WP_002990106.1 | endonuclease III | - |
| G8B35_RS05460 (G8B35_05475) | - | 1082075..1082758 (-) | 684 | WP_011184446.1 | DnaD domain-containing protein | - |
| G8B35_RS05465 (G8B35_05480) | - | 1082839..1083357 (-) | 519 | WP_002990109.1 | adenine phosphoribosyltransferase | - |
| G8B35_RS05470 (G8B35_05485) | recJ | 1083508..1085718 (-) | 2211 | WP_011528535.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| G8B35_RS05475 (G8B35_05490) | - | 1085715..1086479 (-) | 765 | WP_021299305.1 | SDR family oxidoreductase | - |
| G8B35_RS05480 (G8B35_05495) | rnz | 1086479..1087408 (-) | 930 | WP_009881223.1 | ribonuclease Z | - |
| G8B35_RS05485 (G8B35_05500) | - | 1087423..1088058 (-) | 636 | WP_002990114.1 | cystathionine beta-lyase | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7224.11 Da Isoelectric Point: 4.0606
>NTDB_id=427262 G8B35_RS05155 WP_011528571.1 1038248..1038436(-) (prx) [Streptococcus pyogenes strain ABC3]
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
Nucleotide
Download Length: 189 bp
>NTDB_id=427262 G8B35_RS05155 WP_011528571.1 1038248..1038436(-) (prx) [Streptococcus pyogenes strain ABC3]
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
96.774 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
96.774 |
0.694 |
| prx | Streptococcus pyogenes MGAS315 |
90.698 |
69.355 |
0.629 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
66.129 |
0.565 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |