Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | G8B37_RS05145 | Genome accession | NZ_CP049695 |
| Coordinates | 1038607..1038795 (-) | Length | 62 a.a. |
| NCBI ID | WP_011528571.1 | Uniprot ID | A0A660A3N3 |
| Organism | Streptococcus pyogenes strain ABC76 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1038607..1088416 | 1038607..1038795 | within | 0 |
Gene organization within MGE regions
Location: 1038607..1088416
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G8B37_RS05145 (G8B37_05175) | prx | 1038607..1038795 (-) | 189 | WP_011528571.1 | hypothetical protein | Regulator |
| G8B37_RS05150 (G8B37_05180) | sda3 | 1039033..1039833 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| G8B37_RS09485 | - | 1040105..1040236 (+) | 132 | WP_021775281.1 | hypothetical protein | - |
| G8B37_RS05160 (G8B37_05190) | - | 1040607..1041266 (-) | 660 | WP_011528570.1 | hypothetical protein | - |
| G8B37_RS05165 (G8B37_05195) | - | 1041266..1041487 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| G8B37_RS05170 (G8B37_05200) | - | 1041497..1042270 (-) | 774 | WP_011528569.1 | hypothetical protein | - |
| G8B37_RS05175 (G8B37_05205) | - | 1042281..1042883 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| G8B37_RS05180 (G8B37_05210) | - | 1042895..1043659 (-) | 765 | WP_011054797.1 | CHAP domain-containing protein | - |
| G8B37_RS05185 (G8B37_05215) | - | 1043661..1043993 (-) | 333 | WP_011054798.1 | phage holin | - |
| G8B37_RS05190 (G8B37_05220) | - | 1043993..1044316 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| G8B37_RS09490 | - | 1044330..1044452 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| G8B37_RS05195 (G8B37_05225) | - | 1044466..1044813 (-) | 348 | WP_009880247.1 | DUF1366 domain-containing protein | - |
| G8B37_RS05200 (G8B37_05230) | - | 1044824..1046686 (-) | 1863 | WP_011528568.1 | DUF859 family phage minor structural protein | - |
| G8B37_RS05205 (G8B37_05235) | - | 1046691..1050140 (-) | 3450 | WP_011528567.1 | glucosaminidase domain-containing protein | - |
| G8B37_RS05210 (G8B37_05240) | - | 1050141..1051625 (-) | 1485 | WP_011528566.1 | distal tail protein Dit | - |
| G8B37_RS05215 (G8B37_05245) | - | 1051626..1053431 (-) | 1806 | WP_011528565.1 | tail protein | - |
| G8B37_RS05220 (G8B37_05250) | - | 1053424..1053882 (-) | 459 | WP_011528564.1 | hypothetical protein | - |
| G8B37_RS05225 (G8B37_05255) | - | 1053855..1054172 (-) | 318 | WP_011528563.1 | hypothetical protein | - |
| G8B37_RS05230 (G8B37_05260) | - | 1054185..1054691 (-) | 507 | WP_079890482.1 | phage major tail protein, TP901-1 family | - |
| G8B37_RS05235 (G8B37_05265) | - | 1054703..1055113 (-) | 411 | WP_011528561.1 | DUF5072 family protein | - |
| G8B37_RS05240 (G8B37_05270) | - | 1055115..1055510 (-) | 396 | WP_011528560.1 | hypothetical protein | - |
| G8B37_RS05245 (G8B37_05275) | - | 1055507..1055818 (-) | 312 | WP_011528559.1 | hypothetical protein | - |
| G8B37_RS05250 (G8B37_05280) | - | 1055815..1056159 (-) | 345 | WP_011528558.1 | hypothetical protein | - |
| G8B37_RS05255 (G8B37_05285) | - | 1056173..1056466 (-) | 294 | WP_011528557.1 | HeH/LEM domain-containing protein | - |
| G8B37_RS05260 (G8B37_05290) | - | 1056478..1057368 (-) | 891 | WP_011528556.1 | hypothetical protein | - |
| G8B37_RS05265 (G8B37_05295) | - | 1057387..1057956 (-) | 570 | WP_021299309.1 | DUF4355 domain-containing protein | - |
| G8B37_RS05270 (G8B37_05300) | - | 1058068..1058298 (-) | 231 | WP_011528554.1 | hypothetical protein | - |
| G8B37_RS05275 (G8B37_05305) | - | 1058305..1059213 (-) | 909 | WP_011528553.1 | minor capsid protein | - |
| G8B37_RS05280 (G8B37_05310) | - | 1059182..1060507 (-) | 1326 | WP_011528552.1 | phage portal protein | - |
| G8B37_RS05285 (G8B37_05315) | - | 1060507..1061781 (-) | 1275 | WP_021299302.1 | PBSX family phage terminase large subunit | - |
| G8B37_RS05290 (G8B37_05320) | - | 1061771..1062151 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| G8B37_RS05295 (G8B37_05325) | - | 1062238..1062456 (+) | 219 | WP_011528550.1 | hypothetical protein | - |
| G8B37_RS05300 (G8B37_05330) | - | 1062820..1063260 (-) | 441 | WP_011017866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| G8B37_RS05305 (G8B37_05335) | - | 1063534..1063704 (-) | 171 | WP_164997036.1 | hypothetical protein | - |
| G8B37_RS05310 (G8B37_05340) | - | 1063701..1064207 (-) | 507 | WP_011054751.1 | DUF1642 domain-containing protein | - |
| G8B37_RS05315 (G8B37_05345) | - | 1064204..1064374 (-) | 171 | WP_011054752.1 | hypothetical protein | - |
| G8B37_RS05320 (G8B37_05350) | - | 1064371..1064775 (-) | 405 | WP_011054753.1 | YopX family protein | - |
| G8B37_RS05325 (G8B37_05355) | - | 1064785..1065054 (-) | 270 | WP_002987593.1 | hypothetical protein | - |
| G8B37_RS05330 (G8B37_05360) | - | 1065051..1065335 (-) | 285 | WP_011017568.1 | DUF3310 domain-containing protein | - |
| G8B37_RS09620 | - | 1065329..1065580 (-) | 252 | WP_011528549.1 | hypothetical protein | - |
| G8B37_RS05335 (G8B37_05365) | - | 1065577..1065933 (-) | 357 | WP_011018138.1 | hypothetical protein | - |
| G8B37_RS05340 (G8B37_05370) | - | 1065917..1066237 (-) | 321 | WP_002995960.1 | VRR-NUC domain-containing protein | - |
| G8B37_RS05345 (G8B37_05375) | - | 1066482..1067495 (-) | 1014 | WP_227875583.1 | phage/plasmid primase, P4 family | - |
| G8B37_RS09665 | - | 1067408..1067962 (-) | 555 | WP_002995962.1 | hypothetical protein | - |
| G8B37_RS05350 (G8B37_05380) | - | 1067952..1068764 (-) | 813 | WP_011528547.1 | bifunctional DNA primase/polymerase | - |
| G8B37_RS05355 (G8B37_05385) | - | 1068767..1069225 (-) | 459 | WP_002995969.1 | DUF669 domain-containing protein | - |
| G8B37_RS05360 (G8B37_05390) | - | 1069241..1070470 (-) | 1230 | WP_011528546.1 | DEAD/DEAH box helicase | - |
| G8B37_RS05365 (G8B37_05395) | - | 1070572..1071252 (-) | 681 | WP_002995975.1 | AAA family ATPase | - |
| G8B37_RS05370 (G8B37_05400) | - | 1071253..1071735 (-) | 483 | WP_011528545.1 | siphovirus Gp157 family protein | - |
| G8B37_RS05375 (G8B37_05405) | - | 1071962..1072276 (-) | 315 | WP_011528544.1 | helix-turn-helix transcriptional regulator | - |
| G8B37_RS09500 | - | 1072292..1072426 (-) | 135 | WP_011528543.1 | hypothetical protein | - |
| G8B37_RS05380 (G8B37_05410) | - | 1072457..1072708 (-) | 252 | WP_011528542.1 | AlpA family transcriptional regulator | - |
| G8B37_RS05385 (G8B37_05415) | - | 1072803..1073021 (-) | 219 | WP_009881062.1 | helix-turn-helix domain-containing protein | - |
| G8B37_RS05390 (G8B37_05420) | - | 1073210..1073569 (+) | 360 | WP_011528540.1 | helix-turn-helix transcriptional regulator | - |
| G8B37_RS05395 (G8B37_05425) | - | 1073553..1073930 (+) | 378 | WP_011054824.1 | ImmA/IrrE family metallo-endopeptidase | - |
| G8B37_RS05400 (G8B37_05430) | - | 1073941..1074093 (+) | 153 | WP_011054825.1 | hypothetical protein | - |
| G8B37_RS05405 (G8B37_05435) | - | 1074264..1074950 (+) | 687 | WP_011528539.1 | hypothetical protein | - |
| G8B37_RS05410 (G8B37_05440) | - | 1075072..1076211 (+) | 1140 | WP_011528538.1 | site-specific integrase | - |
| G8B37_RS05415 (G8B37_05445) | rfbB | 1076294..1077334 (-) | 1041 | WP_002984881.1 | dTDP-glucose 4,6-dehydratase | - |
| G8B37_RS05420 (G8B37_05450) | - | 1077578..1078171 (-) | 594 | WP_002990099.1 | dTDP-4-dehydrorhamnose 3,5-epimerase family protein | - |
| G8B37_RS05425 (G8B37_05455) | rfbA | 1078171..1079040 (-) | 870 | WP_002992970.1 | glucose-1-phosphate thymidylyltransferase RfbA | - |
| G8B37_RS05430 (G8B37_05460) | - | 1079098..1080204 (-) | 1107 | WP_011528537.1 | FAD-binding oxidoreductase | - |
| G8B37_RS05435 (G8B37_05465) | - | 1080244..1081032 (-) | 789 | WP_021299315.1 | Nif3-like dinuclear metal center hexameric protein | - |
| G8B37_RS05440 (G8B37_05470) | - | 1081022..1081708 (-) | 687 | WP_002990104.1 | tRNA (adenine(22)-N(1))-methyltransferase TrmK | - |
| G8B37_RS05445 (G8B37_05475) | nth | 1081780..1082436 (-) | 657 | WP_002990106.1 | endonuclease III | - |
| G8B37_RS05450 (G8B37_05480) | - | 1082433..1083116 (-) | 684 | WP_011184446.1 | DnaD domain-containing protein | - |
| G8B37_RS05455 (G8B37_05485) | - | 1083197..1083715 (-) | 519 | WP_002990109.1 | adenine phosphoribosyltransferase | - |
| G8B37_RS05460 (G8B37_05490) | recJ | 1083866..1086076 (-) | 2211 | WP_011528535.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| G8B37_RS05465 (G8B37_05495) | - | 1086073..1086837 (-) | 765 | WP_021299305.1 | SDR family oxidoreductase | - |
| G8B37_RS05470 (G8B37_05500) | rnz | 1086837..1087766 (-) | 930 | WP_009881223.1 | ribonuclease Z | - |
| G8B37_RS05475 (G8B37_05505) | - | 1087781..1088416 (-) | 636 | WP_002990114.1 | cystathionine beta-lyase | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7224.11 Da Isoelectric Point: 4.0606
>NTDB_id=427150 G8B37_RS05145 WP_011528571.1 1038607..1038795(-) (prx) [Streptococcus pyogenes strain ABC76]
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
Nucleotide
Download Length: 189 bp
>NTDB_id=427150 G8B37_RS05145 WP_011528571.1 1038607..1038795(-) (prx) [Streptococcus pyogenes strain ABC76]
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
96.774 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
96.774 |
0.694 |
| prx | Streptococcus pyogenes MGAS315 |
90.698 |
69.355 |
0.629 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
66.129 |
0.565 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |