Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | G8B37_RS03400 | Genome accession | NZ_CP049695 |
| Coordinates | 659078..659260 (+) | Length | 60 a.a. |
| NCBI ID | WP_011528776.1 | Uniprot ID | A0A660A5W9 |
| Organism | Streptococcus pyogenes strain ABC76 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 623594..659260 | 659078..659260 | within | 0 |
Gene organization within MGE regions
Location: 623594..659260
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G8B37_RS03135 (G8B37_03150) | - | 623594..623869 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| G8B37_RS03140 (G8B37_03155) | - | 623958..625100 (-) | 1143 | WP_003051793.1 | site-specific integrase | - |
| G8B37_RS03145 (G8B37_03160) | - | 625224..625742 (-) | 519 | WP_011528799.1 | HIRAN domain-containing protein | - |
| G8B37_RS03150 (G8B37_03165) | - | 625754..626509 (-) | 756 | WP_010922480.1 | XRE family transcriptional regulator | - |
| G8B37_RS03155 (G8B37_03170) | - | 626711..626923 (+) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| G8B37_RS03160 (G8B37_03175) | - | 627193..627504 (+) | 312 | WP_010922478.1 | excisionase | - |
| G8B37_RS03165 (G8B37_03180) | - | 627506..627691 (+) | 186 | WP_010922477.1 | hypothetical protein | - |
| G8B37_RS09460 | - | 627785..628054 (+) | 270 | WP_011106700.1 | replication protein | - |
| G8B37_RS03170 (G8B37_03185) | - | 628180..628566 (+) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| G8B37_RS03175 (G8B37_03190) | - | 628547..628781 (+) | 235 | Protein_566 | hypothetical protein | - |
| G8B37_RS03180 (G8B37_03195) | - | 628778..628918 (+) | 141 | WP_002988354.1 | hypothetical protein | - |
| G8B37_RS03185 (G8B37_03200) | - | 628927..629133 (+) | 207 | WP_002988357.1 | hypothetical protein | - |
| G8B37_RS03190 (G8B37_03205) | - | 629189..629518 (+) | 330 | WP_011528796.1 | hypothetical protein | - |
| G8B37_RS03195 (G8B37_03210) | - | 629521..630442 (+) | 922 | Protein_570 | recombinase RecT | - |
| G8B37_RS03200 (G8B37_03215) | - | 630439..630639 (+) | 201 | WP_000594115.1 | hypothetical protein | - |
| G8B37_RS03205 (G8B37_03220) | - | 630632..631429 (+) | 798 | WP_011054699.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| G8B37_RS03210 (G8B37_03225) | - | 631794..632189 (+) | 396 | WP_011054698.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| G8B37_RS03215 (G8B37_03230) | - | 632186..633532 (+) | 1347 | WP_011054697.1 | PcfJ domain-containing protein | - |
| G8B37_RS03220 (G8B37_03235) | - | 633543..633875 (+) | 333 | WP_011184741.1 | hypothetical protein | - |
| G8B37_RS03225 (G8B37_03240) | - | 633872..634384 (+) | 513 | WP_011054695.1 | hypothetical protein | - |
| G8B37_RS03230 (G8B37_03245) | - | 634420..634737 (+) | 318 | WP_011054694.1 | DUF1372 family protein | - |
| G8B37_RS03235 (G8B37_03250) | - | 634734..634889 (+) | 156 | WP_011054693.1 | hypothetical protein | - |
| G8B37_RS03240 (G8B37_03255) | - | 634886..635137 (+) | 252 | WP_011054692.1 | hypothetical protein | - |
| G8B37_RS03245 (G8B37_03260) | - | 635213..635632 (+) | 420 | WP_011528791.1 | DUF1492 domain-containing protein | - |
| G8B37_RS03250 (G8B37_03265) | - | 635740..636084 (+) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| G8B37_RS03255 (G8B37_03270) | - | 636232..636588 (+) | 357 | WP_002994106.1 | hypothetical protein | - |
| G8B37_RS03260 (G8B37_03275) | - | 636585..637853 (+) | 1269 | WP_010922468.1 | phage portal protein | - |
| G8B37_RS03265 (G8B37_03280) | - | 637846..639339 (+) | 1494 | WP_010922467.1 | hypothetical protein | - |
| G8B37_RS03270 (G8B37_03285) | - | 639345..639569 (+) | 225 | WP_002994100.1 | hypothetical protein | - |
| G8B37_RS03275 (G8B37_03290) | - | 639621..639887 (+) | 267 | WP_011054745.1 | hypothetical protein | - |
| G8B37_RS03280 (G8B37_03295) | - | 639889..640125 (+) | 237 | Protein_587 | hypothetical protein | - |
| G8B37_RS03285 (G8B37_03300) | - | 640207..641622 (+) | 1416 | WP_021299324.1 | phage terminase large subunit-like protein | - |
| G8B37_RS03290 (G8B37_03305) | - | 641702..642163 (+) | 462 | WP_010922462.1 | DUF4355 domain-containing protein | - |
| G8B37_RS03295 (G8B37_03310) | - | 642188..643099 (+) | 912 | WP_011528788.1 | phage major capsid protein | - |
| G8B37_RS03300 (G8B37_03315) | - | 643099..643299 (+) | 201 | WP_010922460.1 | hypothetical protein | - |
| G8B37_RS03305 (G8B37_03320) | - | 643309..643731 (+) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| G8B37_RS03310 (G8B37_03325) | - | 643691..644029 (+) | 339 | WP_011054681.1 | hypothetical protein | - |
| G8B37_RS03315 (G8B37_03330) | - | 644022..644258 (+) | 237 | WP_000032787.1 | hypothetical protein | - |
| G8B37_RS03320 (G8B37_03335) | - | 644259..644594 (+) | 336 | WP_011528787.1 | hypothetical protein | - |
| G8B37_RS03325 (G8B37_03340) | - | 644606..645184 (+) | 579 | WP_014635577.1 | hypothetical protein | - |
| G8B37_RS03330 (G8B37_03345) | - | 645195..645458 (+) | 264 | WP_003047548.1 | hypothetical protein | - |
| G8B37_RS03335 (G8B37_03350) | - | 645473..645844 (+) | 372 | WP_011528785.1 | DUF5361 domain-containing protein | - |
| G8B37_RS03340 (G8B37_03355) | - | 645844..648201 (+) | 2358 | WP_011528784.1 | hypothetical protein | - |
| G8B37_RS03345 (G8B37_03360) | - | 648198..648893 (+) | 696 | WP_002992579.1 | hypothetical protein | - |
| G8B37_RS03350 (G8B37_03365) | - | 648875..650851 (+) | 1977 | WP_219222227.1 | phage tail spike protein | - |
| G8B37_RS03355 (G8B37_03370) | hylP | 650848..651963 (+) | 1116 | WP_011528782.1 | hyaluronoglucosaminidase | - |
| G8B37_RS03360 (G8B37_03375) | - | 651978..653759 (+) | 1782 | WP_011528781.1 | gp58-like family protein | - |
| G8B37_RS03365 (G8B37_03380) | - | 653768..654196 (+) | 429 | WP_011528780.1 | DUF1617 family protein | - |
| G8B37_RS03370 (G8B37_03385) | - | 654199..654831 (+) | 633 | WP_011528779.1 | hypothetical protein | - |
| G8B37_RS03375 (G8B37_03390) | - | 654843..655115 (+) | 273 | WP_011017397.1 | hypothetical protein | - |
| G8B37_RS03380 (G8B37_03395) | - | 655112..655339 (+) | 228 | WP_003058873.1 | phage holin | - |
| G8B37_RS03385 (G8B37_03400) | - | 655458..656675 (+) | 1218 | WP_011528778.1 | peptidoglycan amidohydrolase family protein | - |
| G8B37_RS03390 (G8B37_03405) | - | 656811..657935 (+) | 1125 | WP_002988467.1 | Fic family protein | - |
| G8B37_RS03395 (G8B37_03410) | entC3 | 658183..658965 (+) | 783 | WP_002988472.1 | enterotoxin type C3 EntC3 | - |
| G8B37_RS03400 (G8B37_03415) | prx | 659078..659260 (+) | 183 | WP_011528776.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6840.81 Da Isoelectric Point: 4.7023
>NTDB_id=427144 G8B37_RS03400 WP_011528776.1 659078..659260(+) (prx) [Streptococcus pyogenes strain ABC76]
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=427144 G8B37_RS03400 WP_011528776.1 659078..659260(+) (prx) [Streptococcus pyogenes strain ABC76]
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
81.395 |
71.667 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |