Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | G8B39_RS05150 | Genome accession | NZ_CP049693 |
| Coordinates | 1038435..1038623 (-) | Length | 62 a.a. |
| NCBI ID | WP_011528571.1 | Uniprot ID | A0A660A3N3 |
| Organism | Streptococcus pyogenes strain ABC155 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1038435..1088243 | 1038435..1038623 | within | 0 |
Gene organization within MGE regions
Location: 1038435..1088243
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G8B39_RS05150 (G8B39_05180) | prx | 1038435..1038623 (-) | 189 | WP_011528571.1 | hypothetical protein | Regulator |
| G8B39_RS05155 (G8B39_05185) | sda3 | 1038861..1039661 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| G8B39_RS05160 (G8B39_05190) | - | 1039933..1040367 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| G8B39_RS05165 (G8B39_05195) | - | 1040436..1041095 (-) | 660 | WP_011528570.1 | hypothetical protein | - |
| G8B39_RS05170 (G8B39_05200) | - | 1041095..1041316 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| G8B39_RS05175 (G8B39_05205) | - | 1041326..1042099 (-) | 774 | WP_011528569.1 | hypothetical protein | - |
| G8B39_RS05180 (G8B39_05210) | - | 1042110..1042712 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| G8B39_RS05185 (G8B39_05215) | - | 1042724..1043488 (-) | 765 | WP_011054797.1 | CHAP domain-containing protein | - |
| G8B39_RS05190 (G8B39_05220) | - | 1043490..1043822 (-) | 333 | WP_011054798.1 | phage holin | - |
| G8B39_RS05195 (G8B39_05225) | - | 1043822..1044145 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| G8B39_RS09505 | - | 1044159..1044281 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| G8B39_RS05200 (G8B39_05230) | - | 1044295..1044642 (-) | 348 | WP_009880247.1 | DUF1366 domain-containing protein | - |
| G8B39_RS05205 (G8B39_05235) | - | 1044653..1046515 (-) | 1863 | WP_011528568.1 | DUF859 family phage minor structural protein | - |
| G8B39_RS05210 (G8B39_05240) | - | 1046520..1049969 (-) | 3450 | WP_011528567.1 | glucosaminidase domain-containing protein | - |
| G8B39_RS05215 (G8B39_05245) | - | 1049970..1051454 (-) | 1485 | WP_011528566.1 | distal tail protein Dit | - |
| G8B39_RS05220 (G8B39_05250) | - | 1051455..1053260 (-) | 1806 | WP_011528565.1 | tail protein | - |
| G8B39_RS05225 (G8B39_05255) | - | 1053253..1053711 (-) | 459 | WP_011528564.1 | hypothetical protein | - |
| G8B39_RS05230 (G8B39_05260) | - | 1053684..1054001 (-) | 318 | WP_011528563.1 | hypothetical protein | - |
| G8B39_RS05235 (G8B39_05265) | - | 1054014..1054520 (-) | 507 | WP_079890482.1 | phage major tail protein, TP901-1 family | - |
| G8B39_RS05240 (G8B39_05270) | - | 1054532..1054942 (-) | 411 | WP_011528561.1 | DUF5072 family protein | - |
| G8B39_RS05245 (G8B39_05275) | - | 1054944..1055339 (-) | 396 | WP_011528560.1 | hypothetical protein | - |
| G8B39_RS05250 (G8B39_05280) | - | 1055336..1055647 (-) | 312 | WP_011528559.1 | hypothetical protein | - |
| G8B39_RS05255 (G8B39_05285) | - | 1055644..1055988 (-) | 345 | WP_011528558.1 | hypothetical protein | - |
| G8B39_RS05260 (G8B39_05290) | - | 1056002..1056295 (-) | 294 | WP_011528557.1 | HeH/LEM domain-containing protein | - |
| G8B39_RS09645 (G8B39_05295) | - | 1056307..1057197 (-) | 891 | Protein_982 | phage capsid protein | - |
| G8B39_RS05270 (G8B39_05300) | - | 1057216..1057785 (-) | 570 | WP_021299309.1 | DUF4355 domain-containing protein | - |
| G8B39_RS05275 (G8B39_05305) | - | 1057897..1058127 (-) | 231 | WP_011528554.1 | hypothetical protein | - |
| G8B39_RS05280 (G8B39_05310) | - | 1058134..1059042 (-) | 909 | WP_011528553.1 | minor capsid protein | - |
| G8B39_RS05285 (G8B39_05315) | - | 1059011..1060336 (-) | 1326 | WP_011528552.1 | phage portal protein | - |
| G8B39_RS05290 (G8B39_05320) | - | 1060336..1061610 (-) | 1275 | WP_021299302.1 | PBSX family phage terminase large subunit | - |
| G8B39_RS05295 (G8B39_05325) | - | 1061600..1061980 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| G8B39_RS05300 (G8B39_05330) | - | 1062067..1062285 (+) | 219 | WP_011528550.1 | hypothetical protein | - |
| G8B39_RS05305 (G8B39_05335) | - | 1062648..1063088 (-) | 441 | WP_011017866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| G8B39_RS05310 (G8B39_05340) | - | 1063362..1063532 (-) | 171 | WP_164997036.1 | hypothetical protein | - |
| G8B39_RS05315 (G8B39_05345) | - | 1063529..1064035 (-) | 507 | WP_011054751.1 | DUF1642 domain-containing protein | - |
| G8B39_RS05320 (G8B39_05350) | - | 1064032..1064202 (-) | 171 | WP_011054752.1 | hypothetical protein | - |
| G8B39_RS05325 (G8B39_05355) | - | 1064199..1064603 (-) | 405 | WP_011054753.1 | YopX family protein | - |
| G8B39_RS05330 (G8B39_05360) | - | 1064613..1064882 (-) | 270 | WP_002987593.1 | hypothetical protein | - |
| G8B39_RS05335 (G8B39_05365) | - | 1064879..1065163 (-) | 285 | WP_011017568.1 | DUF3310 domain-containing protein | - |
| G8B39_RS09650 | - | 1065157..1065408 (-) | 252 | WP_011528549.1 | hypothetical protein | - |
| G8B39_RS05340 (G8B39_05370) | - | 1065405..1065761 (-) | 357 | WP_011018138.1 | hypothetical protein | - |
| G8B39_RS05345 (G8B39_05375) | - | 1065745..1066065 (-) | 321 | WP_002995960.1 | VRR-NUC domain-containing protein | - |
| G8B39_RS05350 (G8B39_05380) | - | 1066310..1067323 (-) | 1014 | WP_227875583.1 | phage/plasmid primase, P4 family | - |
| G8B39_RS09695 | - | 1067236..1067790 (-) | 555 | WP_002995962.1 | hypothetical protein | - |
| G8B39_RS05355 (G8B39_05385) | - | 1067780..1068592 (-) | 813 | WP_011528547.1 | bifunctional DNA primase/polymerase | - |
| G8B39_RS05360 (G8B39_05390) | - | 1068595..1069053 (-) | 459 | WP_002995969.1 | DUF669 domain-containing protein | - |
| G8B39_RS05365 (G8B39_05395) | - | 1069069..1070298 (-) | 1230 | WP_219233494.1 | DEAD/DEAH box helicase | - |
| G8B39_RS05370 (G8B39_05400) | - | 1070400..1071080 (-) | 681 | WP_002995975.1 | AAA family ATPase | - |
| G8B39_RS05375 (G8B39_05405) | - | 1071081..1071563 (-) | 483 | WP_011528545.1 | siphovirus Gp157 family protein | - |
| G8B39_RS05380 (G8B39_05410) | - | 1071790..1072104 (-) | 315 | WP_011528544.1 | helix-turn-helix transcriptional regulator | - |
| G8B39_RS09525 | - | 1072120..1072254 (-) | 135 | WP_011528543.1 | hypothetical protein | - |
| G8B39_RS05385 (G8B39_05415) | - | 1072285..1072536 (-) | 252 | WP_011528542.1 | AlpA family transcriptional regulator | - |
| G8B39_RS05390 (G8B39_05420) | - | 1072609..1072848 (-) | 240 | WP_063815423.1 | helix-turn-helix domain-containing protein | - |
| G8B39_RS05395 (G8B39_05425) | - | 1073037..1073396 (+) | 360 | WP_011528540.1 | helix-turn-helix transcriptional regulator | - |
| G8B39_RS05400 (G8B39_05430) | - | 1073380..1073757 (+) | 378 | WP_011054824.1 | ImmA/IrrE family metallo-endopeptidase | - |
| G8B39_RS05405 (G8B39_05435) | - | 1073768..1073920 (+) | 153 | WP_011054825.1 | hypothetical protein | - |
| G8B39_RS05410 (G8B39_05440) | - | 1074091..1074777 (+) | 687 | WP_011528539.1 | hypothetical protein | - |
| G8B39_RS05415 (G8B39_05445) | - | 1074899..1076038 (+) | 1140 | WP_011528538.1 | site-specific integrase | - |
| G8B39_RS05420 (G8B39_05450) | rfbB | 1076121..1077161 (-) | 1041 | WP_002984881.1 | dTDP-glucose 4,6-dehydratase | - |
| G8B39_RS05425 (G8B39_05455) | - | 1077405..1077998 (-) | 594 | WP_002990099.1 | dTDP-4-dehydrorhamnose 3,5-epimerase family protein | - |
| G8B39_RS05430 (G8B39_05460) | rfbA | 1077998..1078867 (-) | 870 | WP_002992970.1 | glucose-1-phosphate thymidylyltransferase RfbA | - |
| G8B39_RS05435 (G8B39_05465) | - | 1078925..1080031 (-) | 1107 | WP_011528537.1 | FAD-binding oxidoreductase | - |
| G8B39_RS05440 (G8B39_05470) | - | 1080071..1080859 (-) | 789 | WP_021299315.1 | Nif3-like dinuclear metal center hexameric protein | - |
| G8B39_RS05445 (G8B39_05475) | - | 1080849..1081535 (-) | 687 | WP_002990104.1 | tRNA (adenine(22)-N(1))-methyltransferase TrmK | - |
| G8B39_RS05450 (G8B39_05480) | nth | 1081607..1082263 (-) | 657 | WP_002990106.1 | endonuclease III | - |
| G8B39_RS05455 (G8B39_05485) | - | 1082260..1082943 (-) | 684 | WP_011184446.1 | DnaD domain-containing protein | - |
| G8B39_RS05460 (G8B39_05490) | - | 1083024..1083542 (-) | 519 | WP_002990109.1 | adenine phosphoribosyltransferase | - |
| G8B39_RS05465 (G8B39_05495) | recJ | 1083693..1085903 (-) | 2211 | WP_011528535.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| G8B39_RS05470 (G8B39_05500) | - | 1085900..1086664 (-) | 765 | WP_002984893.1 | SDR family oxidoreductase | - |
| G8B39_RS05475 (G8B39_05505) | rnz | 1086664..1087593 (-) | 930 | WP_009881223.1 | ribonuclease Z | - |
| G8B39_RS05480 (G8B39_05510) | - | 1087608..1088243 (-) | 636 | WP_002990114.1 | cystathionine beta-lyase | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7224.11 Da Isoelectric Point: 4.0606
>NTDB_id=427038 G8B39_RS05150 WP_011528571.1 1038435..1038623(-) (prx) [Streptococcus pyogenes strain ABC155]
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
Nucleotide
Download Length: 189 bp
>NTDB_id=427038 G8B39_RS05150 WP_011528571.1 1038435..1038623(-) (prx) [Streptococcus pyogenes strain ABC155]
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
96.774 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
96.774 |
0.694 |
| prx | Streptococcus pyogenes MGAS315 |
90.698 |
69.355 |
0.629 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
66.129 |
0.565 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |