Detailed information    

insolico Bioinformatically predicted

Overview


Name   prx   Type   Regulator
Locus tag   G8B39_RS05150 Genome accession   NZ_CP049693
Coordinates   1038435..1038623 (-) Length   62 a.a.
NCBI ID   WP_011528571.1    Uniprot ID   A0A660A3N3
Organism   Streptococcus pyogenes strain ABC155     
Function   Inhibit ComR activation (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1038435..1088243 1038435..1038623 within 0


Gene organization within MGE regions


Location: 1038435..1088243
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  G8B39_RS05150 (G8B39_05180) prx 1038435..1038623 (-) 189 WP_011528571.1 hypothetical protein Regulator
  G8B39_RS05155 (G8B39_05185) sda3 1038861..1039661 (+) 801 WP_011285611.1 streptodornase Sda3 -
  G8B39_RS05160 (G8B39_05190) - 1039933..1040367 (+) 435 WP_011017966.1 hypothetical protein -
  G8B39_RS05165 (G8B39_05195) - 1040436..1041095 (-) 660 WP_011528570.1 hypothetical protein -
  G8B39_RS05170 (G8B39_05200) - 1041095..1041316 (-) 222 WP_009880241.1 hypothetical protein -
  G8B39_RS05175 (G8B39_05205) - 1041326..1042099 (-) 774 WP_011528569.1 hypothetical protein -
  G8B39_RS05180 (G8B39_05210) - 1042110..1042712 (-) 603 WP_011054796.1 hypothetical protein -
  G8B39_RS05185 (G8B39_05215) - 1042724..1043488 (-) 765 WP_011054797.1 CHAP domain-containing protein -
  G8B39_RS05190 (G8B39_05220) - 1043490..1043822 (-) 333 WP_011054798.1 phage holin -
  G8B39_RS05195 (G8B39_05225) - 1043822..1044145 (-) 324 WP_015055952.1 hypothetical protein -
  G8B39_RS09505 - 1044159..1044281 (-) 123 WP_015055953.1 hypothetical protein -
  G8B39_RS05200 (G8B39_05230) - 1044295..1044642 (-) 348 WP_009880247.1 DUF1366 domain-containing protein -
  G8B39_RS05205 (G8B39_05235) - 1044653..1046515 (-) 1863 WP_011528568.1 DUF859 family phage minor structural protein -
  G8B39_RS05210 (G8B39_05240) - 1046520..1049969 (-) 3450 WP_011528567.1 glucosaminidase domain-containing protein -
  G8B39_RS05215 (G8B39_05245) - 1049970..1051454 (-) 1485 WP_011528566.1 distal tail protein Dit -
  G8B39_RS05220 (G8B39_05250) - 1051455..1053260 (-) 1806 WP_011528565.1 tail protein -
  G8B39_RS05225 (G8B39_05255) - 1053253..1053711 (-) 459 WP_011528564.1 hypothetical protein -
  G8B39_RS05230 (G8B39_05260) - 1053684..1054001 (-) 318 WP_011528563.1 hypothetical protein -
  G8B39_RS05235 (G8B39_05265) - 1054014..1054520 (-) 507 WP_079890482.1 phage major tail protein, TP901-1 family -
  G8B39_RS05240 (G8B39_05270) - 1054532..1054942 (-) 411 WP_011528561.1 DUF5072 family protein -
  G8B39_RS05245 (G8B39_05275) - 1054944..1055339 (-) 396 WP_011528560.1 hypothetical protein -
  G8B39_RS05250 (G8B39_05280) - 1055336..1055647 (-) 312 WP_011528559.1 hypothetical protein -
  G8B39_RS05255 (G8B39_05285) - 1055644..1055988 (-) 345 WP_011528558.1 hypothetical protein -
  G8B39_RS05260 (G8B39_05290) - 1056002..1056295 (-) 294 WP_011528557.1 HeH/LEM domain-containing protein -
  G8B39_RS09645 (G8B39_05295) - 1056307..1057197 (-) 891 Protein_982 phage capsid protein -
  G8B39_RS05270 (G8B39_05300) - 1057216..1057785 (-) 570 WP_021299309.1 DUF4355 domain-containing protein -
  G8B39_RS05275 (G8B39_05305) - 1057897..1058127 (-) 231 WP_011528554.1 hypothetical protein -
  G8B39_RS05280 (G8B39_05310) - 1058134..1059042 (-) 909 WP_011528553.1 minor capsid protein -
  G8B39_RS05285 (G8B39_05315) - 1059011..1060336 (-) 1326 WP_011528552.1 phage portal protein -
  G8B39_RS05290 (G8B39_05320) - 1060336..1061610 (-) 1275 WP_021299302.1 PBSX family phage terminase large subunit -
  G8B39_RS05295 (G8B39_05325) - 1061600..1061980 (-) 381 WP_011285571.1 hypothetical protein -
  G8B39_RS05300 (G8B39_05330) - 1062067..1062285 (+) 219 WP_011528550.1 hypothetical protein -
  G8B39_RS05305 (G8B39_05335) - 1062648..1063088 (-) 441 WP_011017866.1 ArpU family phage packaging/lysis transcriptional regulator -
  G8B39_RS05310 (G8B39_05340) - 1063362..1063532 (-) 171 WP_164997036.1 hypothetical protein -
  G8B39_RS05315 (G8B39_05345) - 1063529..1064035 (-) 507 WP_011054751.1 DUF1642 domain-containing protein -
  G8B39_RS05320 (G8B39_05350) - 1064032..1064202 (-) 171 WP_011054752.1 hypothetical protein -
  G8B39_RS05325 (G8B39_05355) - 1064199..1064603 (-) 405 WP_011054753.1 YopX family protein -
  G8B39_RS05330 (G8B39_05360) - 1064613..1064882 (-) 270 WP_002987593.1 hypothetical protein -
  G8B39_RS05335 (G8B39_05365) - 1064879..1065163 (-) 285 WP_011017568.1 DUF3310 domain-containing protein -
  G8B39_RS09650 - 1065157..1065408 (-) 252 WP_011528549.1 hypothetical protein -
  G8B39_RS05340 (G8B39_05370) - 1065405..1065761 (-) 357 WP_011018138.1 hypothetical protein -
  G8B39_RS05345 (G8B39_05375) - 1065745..1066065 (-) 321 WP_002995960.1 VRR-NUC domain-containing protein -
  G8B39_RS05350 (G8B39_05380) - 1066310..1067323 (-) 1014 WP_227875583.1 phage/plasmid primase, P4 family -
  G8B39_RS09695 - 1067236..1067790 (-) 555 WP_002995962.1 hypothetical protein -
  G8B39_RS05355 (G8B39_05385) - 1067780..1068592 (-) 813 WP_011528547.1 bifunctional DNA primase/polymerase -
  G8B39_RS05360 (G8B39_05390) - 1068595..1069053 (-) 459 WP_002995969.1 DUF669 domain-containing protein -
  G8B39_RS05365 (G8B39_05395) - 1069069..1070298 (-) 1230 WP_219233494.1 DEAD/DEAH box helicase -
  G8B39_RS05370 (G8B39_05400) - 1070400..1071080 (-) 681 WP_002995975.1 AAA family ATPase -
  G8B39_RS05375 (G8B39_05405) - 1071081..1071563 (-) 483 WP_011528545.1 siphovirus Gp157 family protein -
  G8B39_RS05380 (G8B39_05410) - 1071790..1072104 (-) 315 WP_011528544.1 helix-turn-helix transcriptional regulator -
  G8B39_RS09525 - 1072120..1072254 (-) 135 WP_011528543.1 hypothetical protein -
  G8B39_RS05385 (G8B39_05415) - 1072285..1072536 (-) 252 WP_011528542.1 AlpA family transcriptional regulator -
  G8B39_RS05390 (G8B39_05420) - 1072609..1072848 (-) 240 WP_063815423.1 helix-turn-helix domain-containing protein -
  G8B39_RS05395 (G8B39_05425) - 1073037..1073396 (+) 360 WP_011528540.1 helix-turn-helix transcriptional regulator -
  G8B39_RS05400 (G8B39_05430) - 1073380..1073757 (+) 378 WP_011054824.1 ImmA/IrrE family metallo-endopeptidase -
  G8B39_RS05405 (G8B39_05435) - 1073768..1073920 (+) 153 WP_011054825.1 hypothetical protein -
  G8B39_RS05410 (G8B39_05440) - 1074091..1074777 (+) 687 WP_011528539.1 hypothetical protein -
  G8B39_RS05415 (G8B39_05445) - 1074899..1076038 (+) 1140 WP_011528538.1 site-specific integrase -
  G8B39_RS05420 (G8B39_05450) rfbB 1076121..1077161 (-) 1041 WP_002984881.1 dTDP-glucose 4,6-dehydratase -
  G8B39_RS05425 (G8B39_05455) - 1077405..1077998 (-) 594 WP_002990099.1 dTDP-4-dehydrorhamnose 3,5-epimerase family protein -
  G8B39_RS05430 (G8B39_05460) rfbA 1077998..1078867 (-) 870 WP_002992970.1 glucose-1-phosphate thymidylyltransferase RfbA -
  G8B39_RS05435 (G8B39_05465) - 1078925..1080031 (-) 1107 WP_011528537.1 FAD-binding oxidoreductase -
  G8B39_RS05440 (G8B39_05470) - 1080071..1080859 (-) 789 WP_021299315.1 Nif3-like dinuclear metal center hexameric protein -
  G8B39_RS05445 (G8B39_05475) - 1080849..1081535 (-) 687 WP_002990104.1 tRNA (adenine(22)-N(1))-methyltransferase TrmK -
  G8B39_RS05450 (G8B39_05480) nth 1081607..1082263 (-) 657 WP_002990106.1 endonuclease III -
  G8B39_RS05455 (G8B39_05485) - 1082260..1082943 (-) 684 WP_011184446.1 DnaD domain-containing protein -
  G8B39_RS05460 (G8B39_05490) - 1083024..1083542 (-) 519 WP_002990109.1 adenine phosphoribosyltransferase -
  G8B39_RS05465 (G8B39_05495) recJ 1083693..1085903 (-) 2211 WP_011528535.1 single-stranded-DNA-specific exonuclease RecJ -
  G8B39_RS05470 (G8B39_05500) - 1085900..1086664 (-) 765 WP_002984893.1 SDR family oxidoreductase -
  G8B39_RS05475 (G8B39_05505) rnz 1086664..1087593 (-) 930 WP_009881223.1 ribonuclease Z -
  G8B39_RS05480 (G8B39_05510) - 1087608..1088243 (-) 636 WP_002990114.1 cystathionine beta-lyase -

Sequence


Protein


Download         Length: 62 a.a.        Molecular weight: 7224.11 Da        Isoelectric Point: 4.0606

>NTDB_id=427038 G8B39_RS05150 WP_011528571.1 1038435..1038623(-) (prx) [Streptococcus pyogenes strain ABC155]
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE

Nucleotide


Download         Length: 189 bp        

>NTDB_id=427038 G8B39_RS05150 WP_011528571.1 1038435..1038623(-) (prx) [Streptococcus pyogenes strain ABC155]
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A660A3N3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  prx Streptococcus pyogenes MGAS315

76.667

96.774

0.742

  prx Streptococcus pyogenes MGAS315

76.271

95.161

0.726

  prx Streptococcus pyogenes MGAS8232

76.271

95.161

0.726

  prx Streptococcus pyogenes MGAS315

71.667

96.774

0.694

  prx Streptococcus pyogenes MGAS315

90.698

69.355

0.629

  prx Streptococcus pyogenes MGAS315

85.366

66.129

0.565

  prx Streptococcus pyogenes MGAS315

76.19

67.742

0.516