Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | G8B40_RS06205 | Genome accession | NZ_CP049692 |
| Coordinates | 1222960..1223142 (-) | Length | 60 a.a. |
| NCBI ID | WP_011528776.1 | Uniprot ID | A0A660A5W9 |
| Organism | Streptococcus pyogenes strain ABC157 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1222960..1258625 | 1222960..1223142 | within | 0 |
Gene organization within MGE regions
Location: 1222960..1258625
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G8B40_RS06205 (G8B40_06245) | prx | 1222960..1223142 (-) | 183 | WP_011528776.1 | hypothetical protein | Regulator |
| G8B40_RS06210 (G8B40_06250) | entC3 | 1223255..1224037 (-) | 783 | WP_002988472.1 | enterotoxin type C3 EntC3 | - |
| G8B40_RS06215 (G8B40_06255) | - | 1224285..1225409 (-) | 1125 | WP_002988467.1 | Fic family protein | - |
| G8B40_RS06220 (G8B40_06260) | - | 1225545..1226762 (-) | 1218 | WP_011528778.1 | peptidoglycan amidohydrolase family protein | - |
| G8B40_RS06225 (G8B40_06265) | - | 1226881..1227108 (-) | 228 | WP_003058873.1 | phage holin | - |
| G8B40_RS06230 (G8B40_06270) | - | 1227105..1227377 (-) | 273 | WP_011017397.1 | hypothetical protein | - |
| G8B40_RS06235 (G8B40_06275) | - | 1227389..1228021 (-) | 633 | WP_011528779.1 | hypothetical protein | - |
| G8B40_RS06240 (G8B40_06280) | - | 1228024..1228452 (-) | 429 | WP_011528780.1 | DUF1617 family protein | - |
| G8B40_RS06245 (G8B40_06285) | - | 1228461..1230242 (-) | 1782 | WP_011528781.1 | gp58-like family protein | - |
| G8B40_RS06250 (G8B40_06290) | hylP | 1230257..1231372 (-) | 1116 | WP_011528782.1 | hyaluronoglucosaminidase | - |
| G8B40_RS06255 (G8B40_06295) | - | 1231369..1233345 (-) | 1977 | WP_011528783.1 | phage tail spike protein | - |
| G8B40_RS06260 (G8B40_06300) | - | 1233327..1234022 (-) | 696 | WP_002992579.1 | hypothetical protein | - |
| G8B40_RS06265 (G8B40_06305) | - | 1234019..1236376 (-) | 2358 | WP_011528784.1 | hypothetical protein | - |
| G8B40_RS06270 (G8B40_06310) | - | 1236376..1236747 (-) | 372 | WP_011528785.1 | DUF5361 domain-containing protein | - |
| G8B40_RS06275 (G8B40_06315) | - | 1236762..1237025 (-) | 264 | WP_003047548.1 | hypothetical protein | - |
| G8B40_RS06280 (G8B40_06320) | - | 1237036..1237614 (-) | 579 | WP_014635577.1 | hypothetical protein | - |
| G8B40_RS06285 (G8B40_06325) | - | 1237626..1237961 (-) | 336 | WP_011528787.1 | hypothetical protein | - |
| G8B40_RS06290 (G8B40_06330) | - | 1237962..1238198 (-) | 237 | WP_000032787.1 | hypothetical protein | - |
| G8B40_RS06295 (G8B40_06335) | - | 1238191..1238529 (-) | 339 | WP_011054681.1 | hypothetical protein | - |
| G8B40_RS06300 (G8B40_06340) | - | 1238489..1238911 (-) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| G8B40_RS06305 (G8B40_06345) | - | 1238921..1239121 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| G8B40_RS06310 (G8B40_06350) | - | 1239121..1240032 (-) | 912 | WP_011528788.1 | phage major capsid protein | - |
| G8B40_RS06315 (G8B40_06355) | - | 1240057..1240518 (-) | 462 | WP_010922462.1 | DUF4355 domain-containing protein | - |
| G8B40_RS06320 (G8B40_06360) | - | 1240598..1242013 (-) | 1416 | WP_021299324.1 | phage terminase large subunit-like protein | - |
| G8B40_RS06325 (G8B40_06365) | - | 1242095..1242331 (-) | 237 | Protein_1208 | hypothetical protein | - |
| G8B40_RS06330 (G8B40_06370) | - | 1242333..1242599 (-) | 267 | WP_011054745.1 | hypothetical protein | - |
| G8B40_RS06335 (G8B40_06375) | - | 1242651..1242875 (-) | 225 | WP_002994100.1 | hypothetical protein | - |
| G8B40_RS06340 (G8B40_06380) | - | 1242881..1244374 (-) | 1494 | WP_010922467.1 | hypothetical protein | - |
| G8B40_RS06345 (G8B40_06385) | - | 1244367..1245635 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| G8B40_RS06350 (G8B40_06390) | - | 1245632..1245988 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| G8B40_RS06355 (G8B40_06395) | - | 1246136..1246480 (-) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| G8B40_RS06360 (G8B40_06400) | - | 1246588..1247007 (-) | 420 | WP_011528791.1 | DUF1492 domain-containing protein | - |
| G8B40_RS06365 (G8B40_06405) | - | 1247083..1247334 (-) | 252 | WP_011054692.1 | hypothetical protein | - |
| G8B40_RS06370 (G8B40_06410) | - | 1247331..1247486 (-) | 156 | WP_011054693.1 | hypothetical protein | - |
| G8B40_RS06375 (G8B40_06415) | - | 1247483..1247800 (-) | 318 | WP_011054694.1 | DUF1372 family protein | - |
| G8B40_RS06380 (G8B40_06420) | - | 1247836..1248348 (-) | 513 | WP_011054695.1 | hypothetical protein | - |
| G8B40_RS06385 (G8B40_06425) | - | 1248345..1248677 (-) | 333 | WP_011184741.1 | hypothetical protein | - |
| G8B40_RS06390 (G8B40_06430) | - | 1248688..1250034 (-) | 1347 | WP_011054697.1 | PcfJ domain-containing protein | - |
| G8B40_RS06395 (G8B40_06435) | - | 1250031..1250426 (-) | 396 | WP_011054698.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| G8B40_RS06400 (G8B40_06440) | - | 1250791..1251588 (-) | 798 | WP_011054699.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| G8B40_RS06405 (G8B40_06445) | - | 1251581..1251781 (-) | 201 | WP_000594115.1 | hypothetical protein | - |
| G8B40_RS06410 (G8B40_06450) | - | 1251778..1252699 (-) | 922 | Protein_1225 | recombinase RecT | - |
| G8B40_RS06415 (G8B40_06455) | - | 1252702..1253031 (-) | 330 | WP_011528796.1 | hypothetical protein | - |
| G8B40_RS06420 (G8B40_06460) | - | 1253087..1253293 (-) | 207 | WP_002988357.1 | hypothetical protein | - |
| G8B40_RS06425 (G8B40_06465) | - | 1253302..1253442 (-) | 141 | WP_002988354.1 | hypothetical protein | - |
| G8B40_RS06430 (G8B40_06470) | - | 1253439..1253673 (-) | 235 | Protein_1229 | hypothetical protein | - |
| G8B40_RS06435 (G8B40_06475) | - | 1253654..1254040 (-) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| G8B40_RS09610 | - | 1254166..1254435 (-) | 270 | WP_011106700.1 | replication protein | - |
| G8B40_RS06440 (G8B40_06480) | - | 1254529..1254714 (-) | 186 | WP_010922477.1 | hypothetical protein | - |
| G8B40_RS06445 (G8B40_06485) | - | 1254716..1255027 (-) | 312 | WP_010922478.1 | excisionase | - |
| G8B40_RS06450 (G8B40_06490) | - | 1255297..1255509 (-) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| G8B40_RS06455 (G8B40_06495) | - | 1255710..1256465 (+) | 756 | WP_010922480.1 | XRE family transcriptional regulator | - |
| G8B40_RS06460 (G8B40_06500) | - | 1256477..1256995 (+) | 519 | WP_011528799.1 | HIRAN domain-containing protein | - |
| G8B40_RS06465 (G8B40_06505) | - | 1257119..1258261 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| G8B40_RS06470 (G8B40_06510) | - | 1258350..1258625 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6840.81 Da Isoelectric Point: 4.7023
>NTDB_id=426986 G8B40_RS06205 WP_011528776.1 1222960..1223142(-) (prx) [Streptococcus pyogenes strain ABC157]
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=426986 G8B40_RS06205 WP_011528776.1 1222960..1223142(-) (prx) [Streptococcus pyogenes strain ABC157]
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
81.395 |
71.667 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |