Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | G8B40_RS04450 | Genome accession | NZ_CP049692 |
| Coordinates | 843730..843918 (+) | Length | 62 a.a. |
| NCBI ID | WP_011528571.1 | Uniprot ID | A0A660A3N3 |
| Organism | Streptococcus pyogenes strain ABC157 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 804353..843918 | 843730..843918 | within | 0 |
Gene organization within MGE regions
Location: 804353..843918
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G8B40_RS04175 (G8B40_04205) | - | 804353..804946 (+) | 594 | WP_002990099.1 | dTDP-4-dehydrorhamnose 3,5-epimerase family protein | - |
| G8B40_RS04180 (G8B40_04210) | rfbB | 805190..806230 (+) | 1041 | WP_002984881.1 | dTDP-glucose 4,6-dehydratase | - |
| G8B40_RS04185 (G8B40_04215) | - | 806313..807452 (-) | 1140 | WP_011528538.1 | site-specific integrase | - |
| G8B40_RS04190 (G8B40_04220) | - | 807574..808260 (-) | 687 | WP_011528539.1 | hypothetical protein | - |
| G8B40_RS04195 (G8B40_04225) | - | 808431..808583 (-) | 153 | WP_011054825.1 | hypothetical protein | - |
| G8B40_RS04200 (G8B40_04230) | - | 808594..808971 (-) | 378 | WP_011054824.1 | ImmA/IrrE family metallo-endopeptidase | - |
| G8B40_RS04205 (G8B40_04235) | - | 808955..809314 (-) | 360 | WP_011528540.1 | helix-turn-helix transcriptional regulator | - |
| G8B40_RS04210 (G8B40_04240) | - | 809503..809721 (+) | 219 | WP_009881062.1 | helix-turn-helix domain-containing protein | - |
| G8B40_RS04215 (G8B40_04245) | - | 809816..810067 (+) | 252 | WP_011528542.1 | AlpA family transcriptional regulator | - |
| G8B40_RS09565 | - | 810098..810232 (+) | 135 | WP_011528543.1 | hypothetical protein | - |
| G8B40_RS04220 (G8B40_04250) | - | 810248..810562 (+) | 315 | WP_011528544.1 | helix-turn-helix transcriptional regulator | - |
| G8B40_RS04225 (G8B40_04255) | - | 810789..811271 (+) | 483 | WP_011528545.1 | siphovirus Gp157 family protein | - |
| G8B40_RS04230 (G8B40_04260) | - | 811272..811952 (+) | 681 | WP_002995975.1 | AAA family ATPase | - |
| G8B40_RS04235 (G8B40_04265) | - | 812054..813283 (+) | 1230 | WP_011528546.1 | DEAD/DEAH box helicase | - |
| G8B40_RS04240 (G8B40_04270) | - | 813299..813757 (+) | 459 | WP_002995969.1 | DUF669 domain-containing protein | - |
| G8B40_RS04245 (G8B40_04275) | - | 813760..814572 (+) | 813 | WP_011528547.1 | bifunctional DNA primase/polymerase | - |
| G8B40_RS09740 | - | 814562..815116 (+) | 555 | WP_002995962.1 | hypothetical protein | - |
| G8B40_RS04250 (G8B40_04280) | - | 815044..816042 (+) | 999 | WP_231907796.1 | phage/plasmid primase, P4 family | - |
| G8B40_RS04255 (G8B40_04285) | - | 816287..816607 (+) | 321 | WP_002995960.1 | VRR-NUC domain-containing protein | - |
| G8B40_RS04260 (G8B40_04290) | - | 816591..816947 (+) | 357 | WP_011018138.1 | hypothetical protein | - |
| G8B40_RS09660 | - | 816944..817195 (+) | 252 | WP_011528549.1 | hypothetical protein | - |
| G8B40_RS04265 (G8B40_04295) | - | 817189..817473 (+) | 285 | WP_011017568.1 | DUF3310 domain-containing protein | - |
| G8B40_RS04270 (G8B40_04300) | - | 817470..817739 (+) | 270 | WP_002987593.1 | hypothetical protein | - |
| G8B40_RS04275 (G8B40_04305) | - | 817749..818153 (+) | 405 | WP_011054753.1 | YopX family protein | - |
| G8B40_RS04280 (G8B40_04310) | - | 818150..818320 (+) | 171 | WP_011054752.1 | hypothetical protein | - |
| G8B40_RS04285 (G8B40_04315) | - | 818317..818823 (+) | 507 | WP_011054751.1 | DUF1642 domain-containing protein | - |
| G8B40_RS04290 (G8B40_04320) | - | 818820..818990 (+) | 171 | WP_164997036.1 | hypothetical protein | - |
| G8B40_RS04295 (G8B40_04325) | - | 819264..819704 (+) | 441 | WP_011017866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| G8B40_RS04300 (G8B40_04330) | - | 820068..820286 (-) | 219 | WP_011528550.1 | hypothetical protein | - |
| G8B40_RS04305 (G8B40_04335) | - | 820373..820753 (+) | 381 | WP_011285571.1 | hypothetical protein | - |
| G8B40_RS04310 (G8B40_04340) | - | 820743..822017 (+) | 1275 | WP_021299302.1 | PBSX family phage terminase large subunit | - |
| G8B40_RS04315 (G8B40_04345) | - | 822017..823342 (+) | 1326 | WP_011528552.1 | phage portal protein | - |
| G8B40_RS04320 (G8B40_04350) | - | 823311..824219 (+) | 909 | WP_011528553.1 | minor capsid protein | - |
| G8B40_RS04325 (G8B40_04355) | - | 824226..824456 (+) | 231 | WP_011528554.1 | hypothetical protein | - |
| G8B40_RS04330 (G8B40_04360) | - | 824568..825137 (+) | 570 | WP_021299309.1 | DUF4355 domain-containing protein | - |
| G8B40_RS04335 (G8B40_04365) | - | 825156..826046 (+) | 891 | WP_011528556.1 | hypothetical protein | - |
| G8B40_RS04340 (G8B40_04370) | - | 826058..826351 (+) | 294 | WP_011528557.1 | HeH/LEM domain-containing protein | - |
| G8B40_RS04345 (G8B40_04375) | - | 826365..826709 (+) | 345 | WP_011528558.1 | hypothetical protein | - |
| G8B40_RS04350 (G8B40_04380) | - | 826706..827017 (+) | 312 | WP_011528559.1 | hypothetical protein | - |
| G8B40_RS04355 (G8B40_04385) | - | 827014..827409 (+) | 396 | WP_011528560.1 | hypothetical protein | - |
| G8B40_RS04360 (G8B40_04390) | - | 827411..827821 (+) | 411 | WP_011528561.1 | DUF5072 family protein | - |
| G8B40_RS04365 (G8B40_04395) | - | 827833..828339 (+) | 507 | WP_079890482.1 | phage major tail protein, TP901-1 family | - |
| G8B40_RS04370 (G8B40_04400) | - | 828352..828669 (+) | 318 | WP_011528563.1 | hypothetical protein | - |
| G8B40_RS04375 (G8B40_04405) | - | 828642..829100 (+) | 459 | WP_011528564.1 | hypothetical protein | - |
| G8B40_RS04380 (G8B40_04410) | - | 829093..830898 (+) | 1806 | WP_011528565.1 | tail protein | - |
| G8B40_RS04385 (G8B40_04415) | - | 830899..832383 (+) | 1485 | WP_011528566.1 | distal tail protein Dit | - |
| G8B40_RS04390 (G8B40_04420) | - | 832384..835833 (+) | 3450 | WP_011528567.1 | glucosaminidase domain-containing protein | - |
| G8B40_RS04395 (G8B40_04425) | - | 835838..837700 (+) | 1863 | WP_011528568.1 | DUF859 family phage minor structural protein | - |
| G8B40_RS04400 (G8B40_04430) | - | 837711..838058 (+) | 348 | WP_009880247.1 | DUF1366 domain-containing protein | - |
| G8B40_RS09575 | - | 838072..838194 (+) | 123 | WP_015055953.1 | hypothetical protein | - |
| G8B40_RS04405 (G8B40_04435) | - | 838208..838531 (+) | 324 | WP_015055952.1 | hypothetical protein | - |
| G8B40_RS04410 (G8B40_04440) | - | 838531..838863 (+) | 333 | WP_011054798.1 | phage holin | - |
| G8B40_RS04415 (G8B40_04445) | - | 838865..839629 (+) | 765 | WP_011054797.1 | CHAP domain-containing protein | - |
| G8B40_RS04420 (G8B40_04450) | - | 839641..840243 (+) | 603 | WP_011054796.1 | hypothetical protein | - |
| G8B40_RS04425 (G8B40_04455) | - | 840254..841027 (+) | 774 | WP_011528569.1 | hypothetical protein | - |
| G8B40_RS04430 (G8B40_04460) | - | 841037..841258 (+) | 222 | WP_009880241.1 | hypothetical protein | - |
| G8B40_RS04435 (G8B40_04465) | - | 841258..841917 (+) | 660 | WP_011528570.1 | hypothetical protein | - |
| G8B40_RS04440 (G8B40_04470) | - | 841986..842420 (-) | 435 | WP_011017966.1 | hypothetical protein | - |
| G8B40_RS04445 (G8B40_04475) | sda3 | 842692..843492 (-) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| G8B40_RS04450 (G8B40_04480) | prx | 843730..843918 (+) | 189 | WP_011528571.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7224.11 Da Isoelectric Point: 4.0606
>NTDB_id=426980 G8B40_RS04450 WP_011528571.1 843730..843918(+) (prx) [Streptococcus pyogenes strain ABC157]
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
Nucleotide
Download Length: 189 bp
>NTDB_id=426980 G8B40_RS04450 WP_011528571.1 843730..843918(+) (prx) [Streptococcus pyogenes strain ABC157]
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
96.774 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
96.774 |
0.694 |
| prx | Streptococcus pyogenes MGAS315 |
90.698 |
69.355 |
0.629 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
66.129 |
0.565 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |