Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | G8B41_RS05820 | Genome accession | NZ_CP049691 |
| Coordinates | 1173429..1173611 (-) | Length | 60 a.a. |
| NCBI ID | WP_011528776.1 | Uniprot ID | A0A660A5W9 |
| Organism | Streptococcus pyogenes strain ABC199 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1173429..1201732 | 1173429..1173611 | within | 0 |
Gene organization within MGE regions
Location: 1173429..1201732
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G8B41_RS05820 (G8B41_05860) | prx | 1173429..1173611 (-) | 183 | WP_011528776.1 | hypothetical protein | Regulator |
| G8B41_RS05825 (G8B41_05865) | entC3 | 1173724..1174506 (-) | 783 | WP_002988472.1 | enterotoxin type C3 EntC3 | - |
| G8B41_RS05830 (G8B41_05870) | - | 1174754..1175878 (-) | 1125 | WP_002988467.1 | Fic family protein | - |
| G8B41_RS05835 (G8B41_05875) | - | 1176014..1177231 (-) | 1218 | WP_011528778.1 | peptidoglycan amidohydrolase family protein | - |
| G8B41_RS05840 (G8B41_05880) | - | 1177350..1177577 (-) | 228 | WP_003058873.1 | phage holin | - |
| G8B41_RS05845 (G8B41_05885) | - | 1177574..1177846 (-) | 273 | WP_011017397.1 | hypothetical protein | - |
| G8B41_RS05850 (G8B41_05890) | - | 1177858..1178490 (-) | 633 | WP_011528779.1 | hypothetical protein | - |
| G8B41_RS05855 (G8B41_05895) | - | 1178493..1178921 (-) | 429 | WP_011528780.1 | DUF1617 family protein | - |
| G8B41_RS05860 (G8B41_05900) | - | 1178930..1180711 (-) | 1782 | WP_011528781.1 | gp58-like family protein | - |
| G8B41_RS05865 (G8B41_05905) | hylP | 1180726..1181841 (-) | 1116 | WP_011528782.1 | hyaluronoglucosaminidase | - |
| G8B41_RS05870 (G8B41_05910) | - | 1181838..1183814 (-) | 1977 | WP_011528783.1 | phage tail spike protein | - |
| G8B41_RS05875 (G8B41_05915) | - | 1183796..1184491 (-) | 696 | WP_002992579.1 | hypothetical protein | - |
| G8B41_RS05880 (G8B41_05920) | - | 1184488..1186845 (-) | 2358 | WP_011528784.1 | hypothetical protein | - |
| G8B41_RS05885 (G8B41_05925) | - | 1186845..1187216 (-) | 372 | WP_011528785.1 | DUF5361 domain-containing protein | - |
| G8B41_RS05890 (G8B41_05930) | - | 1187231..1187494 (-) | 264 | WP_003047548.1 | hypothetical protein | - |
| G8B41_RS05895 (G8B41_05935) | - | 1187505..1188083 (-) | 579 | WP_014635577.1 | hypothetical protein | - |
| G8B41_RS05905 (G8B41_05945) | - | 1188207..1188542 (-) | 336 | WP_011528787.1 | hypothetical protein | - |
| G8B41_RS05910 (G8B41_05950) | - | 1188543..1188779 (-) | 237 | WP_000032787.1 | hypothetical protein | - |
| G8B41_RS05915 (G8B41_05955) | - | 1188772..1189109 (-) | 338 | Protein_1123 | hypothetical protein | - |
| G8B41_RS05920 (G8B41_05960) | - | 1189069..1189491 (-) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| G8B41_RS05925 (G8B41_05965) | - | 1189501..1189701 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| G8B41_RS05930 (G8B41_05970) | - | 1189701..1190612 (-) | 912 | WP_011528788.1 | phage major capsid protein | - |
| G8B41_RS05935 (G8B41_05975) | - | 1190637..1191098 (-) | 462 | WP_010922462.1 | DUF4355 domain-containing protein | - |
| G8B41_RS05940 (G8B41_05980) | - | 1191178..1192593 (-) | 1416 | WP_021299324.1 | phage terminase large subunit-like protein | - |
| G8B41_RS05945 (G8B41_05985) | - | 1192675..1192911 (-) | 237 | Protein_1129 | hypothetical protein | - |
| G8B41_RS05950 (G8B41_05990) | - | 1192913..1193179 (-) | 267 | WP_011054745.1 | hypothetical protein | - |
| G8B41_RS05955 (G8B41_05995) | - | 1193231..1193455 (-) | 225 | WP_002994100.1 | hypothetical protein | - |
| G8B41_RS05960 (G8B41_06000) | - | 1193461..1194954 (-) | 1494 | WP_010922467.1 | hypothetical protein | - |
| G8B41_RS05965 (G8B41_06005) | - | 1194947..1196215 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| G8B41_RS05970 (G8B41_06010) | - | 1196212..1196568 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| G8B41_RS05975 (G8B41_06015) | - | 1196716..1197060 (-) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| G8B41_RS05980 (G8B41_06020) | - | 1197168..1197587 (-) | 420 | WP_011528791.1 | DUF1492 domain-containing protein | - |
| G8B41_RS05985 (G8B41_06025) | - | 1197766..1198093 (-) | 328 | Protein_1137 | recombinase RecT | - |
| G8B41_RS05990 (G8B41_06030) | - | 1198096..1198425 (-) | 330 | WP_011528796.1 | hypothetical protein | - |
| G8B41_RS05995 (G8B41_06035) | - | 1198481..1198687 (-) | 207 | WP_002988357.1 | hypothetical protein | - |
| G8B41_RS06000 (G8B41_06040) | - | 1198696..1198836 (-) | 141 | WP_002988354.1 | hypothetical protein | - |
| G8B41_RS06005 (G8B41_06045) | - | 1198833..1199067 (-) | 235 | Protein_1141 | hypothetical protein | - |
| G8B41_RS06010 | - | 1199048..1199251 (-) | 204 | Protein_1142 | DNA replication protein | - |
| G8B41_RS06015 (G8B41_06055) | - | 1199248..1199844 (+) | 597 | Protein_1143 | tyrosine-type recombinase/integrase | - |
| G8B41_RS06020 (G8B41_06060) | - | 1199933..1200208 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| G8B41_RS06025 (G8B41_06065) | - | 1200307..1200894 (-) | 588 | WP_002989129.1 | YpmS family protein | - |
| G8B41_RS06030 (G8B41_06070) | - | 1200872..1201714 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6840.81 Da Isoelectric Point: 4.7023
>NTDB_id=426930 G8B41_RS05820 WP_011528776.1 1173429..1173611(-) (prx) [Streptococcus pyogenes strain ABC199]
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=426930 G8B41_RS05820 WP_011528776.1 1173429..1173611(-) (prx) [Streptococcus pyogenes strain ABC199]
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
81.395 |
71.667 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |