Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | G8B41_RS04065 | Genome accession | NZ_CP049691 |
| Coordinates | 794101..794289 (+) | Length | 62 a.a. |
| NCBI ID | WP_011528571.1 | Uniprot ID | A0A660A3N3 |
| Organism | Streptococcus pyogenes strain ABC199 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 772311..794289 | 794101..794289 | within | 0 |
Gene organization within MGE regions
Location: 772311..794289
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G8B41_RS03925 (G8B41_03955) | - | 772311..772904 (+) | 594 | WP_002990099.1 | dTDP-4-dehydrorhamnose 3,5-epimerase family protein | - |
| G8B41_RS03930 (G8B41_03960) | rfbB | 773148..774188 (+) | 1041 | WP_002984881.1 | dTDP-glucose 4,6-dehydratase | - |
| G8B41_RS03935 (G8B41_03965) | - | 774271..775206 (-) | 936 | WP_060388510.1 | site-specific integrase | - |
| G8B41_RS03940 (G8B41_03970) | - | 775353..775673 (+) | 321 | WP_002995960.1 | VRR-NUC domain-containing protein | - |
| G8B41_RS03945 (G8B41_03975) | - | 775657..776013 (+) | 357 | WP_011018138.1 | hypothetical protein | - |
| G8B41_RS09130 | - | 776010..776261 (+) | 252 | WP_011528549.1 | hypothetical protein | - |
| G8B41_RS03950 (G8B41_03980) | - | 776270..776479 (+) | 210 | Protein_734 | DUF4355 domain-containing protein | - |
| G8B41_RS03955 (G8B41_03985) | - | 776498..777388 (+) | 891 | WP_011528556.1 | hypothetical protein | - |
| G8B41_RS03960 (G8B41_03990) | - | 777400..777693 (+) | 294 | WP_011528557.1 | HeH/LEM domain-containing protein | - |
| G8B41_RS03965 (G8B41_03995) | - | 777707..778051 (+) | 345 | WP_060388512.1 | hypothetical protein | - |
| G8B41_RS03970 (G8B41_04000) | - | 778048..778359 (+) | 312 | WP_011528559.1 | hypothetical protein | - |
| G8B41_RS03975 (G8B41_04005) | - | 778356..778751 (+) | 396 | WP_011528560.1 | hypothetical protein | - |
| G8B41_RS03980 (G8B41_04010) | - | 778753..779163 (+) | 411 | WP_011528561.1 | DUF5072 family protein | - |
| G8B41_RS03985 (G8B41_04015) | - | 779178..779432 (+) | 255 | WP_231494232.1 | phage major tail protein, TP901-1 family | - |
| G8B41_RS03990 (G8B41_04020) | - | 779445..779735 (+) | 291 | WP_060388513.1 | hypothetical protein | - |
| G8B41_RS03995 (G8B41_04025) | - | 779692..781269 (+) | 1578 | WP_231494234.1 | phage tail protein | - |
| G8B41_RS04000 (G8B41_04030) | - | 781270..782754 (+) | 1485 | WP_011528566.1 | distal tail protein Dit | - |
| G8B41_RS04005 (G8B41_04035) | - | 782755..786204 (+) | 3450 | WP_011528567.1 | glucosaminidase domain-containing protein | - |
| G8B41_RS04010 (G8B41_04040) | - | 786209..788071 (+) | 1863 | WP_011528568.1 | DUF859 family phage minor structural protein | - |
| G8B41_RS04015 (G8B41_04045) | - | 788082..788429 (+) | 348 | WP_009880247.1 | DUF1366 domain-containing protein | - |
| G8B41_RS09040 | - | 788443..788565 (+) | 123 | WP_015055953.1 | hypothetical protein | - |
| G8B41_RS04020 (G8B41_04050) | - | 788579..788902 (+) | 324 | WP_015055952.1 | hypothetical protein | - |
| G8B41_RS04025 (G8B41_04055) | - | 788902..789234 (+) | 333 | WP_011054798.1 | phage holin | - |
| G8B41_RS04030 (G8B41_04060) | - | 789236..790000 (+) | 765 | WP_011054797.1 | CHAP domain-containing protein | - |
| G8B41_RS04035 (G8B41_04065) | - | 790012..790614 (+) | 603 | WP_011054796.1 | hypothetical protein | - |
| G8B41_RS04040 (G8B41_04070) | - | 790625..791398 (+) | 774 | WP_011528569.1 | hypothetical protein | - |
| G8B41_RS04045 (G8B41_04075) | - | 791408..791629 (+) | 222 | WP_009880241.1 | hypothetical protein | - |
| G8B41_RS04050 (G8B41_04080) | - | 791629..792288 (+) | 660 | WP_011528570.1 | hypothetical protein | - |
| G8B41_RS04055 (G8B41_04085) | - | 792357..792791 (-) | 435 | WP_011017966.1 | hypothetical protein | - |
| G8B41_RS04060 (G8B41_04090) | sda3 | 793063..793863 (-) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| G8B41_RS04065 (G8B41_04095) | prx | 794101..794289 (+) | 189 | WP_011528571.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7224.11 Da Isoelectric Point: 4.0606
>NTDB_id=426924 G8B41_RS04065 WP_011528571.1 794101..794289(+) (prx) [Streptococcus pyogenes strain ABC199]
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
Nucleotide
Download Length: 189 bp
>NTDB_id=426924 G8B41_RS04065 WP_011528571.1 794101..794289(+) (prx) [Streptococcus pyogenes strain ABC199]
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
96.774 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
96.774 |
0.694 |
| prx | Streptococcus pyogenes MGAS315 |
90.698 |
69.355 |
0.629 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
66.129 |
0.565 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |