Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | G8B43_RS03710 | Genome accession | NZ_CP049689 |
| Coordinates | 700468..700650 (+) | Length | 60 a.a. |
| NCBI ID | WP_011528776.1 | Uniprot ID | A0A660A5W9 |
| Organism | Streptococcus pyogenes strain ABC221 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 663461..700650 | 700468..700650 | within | 0 |
Gene organization within MGE regions
Location: 663461..700650
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G8B43_RS03435 (G8B43_03450) | - | 663479..664321 (+) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
| G8B43_RS03440 (G8B43_03455) | - | 664299..664886 (+) | 588 | WP_002989129.1 | YpmS family protein | - |
| G8B43_RS03445 (G8B43_03460) | - | 664985..665260 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| G8B43_RS03450 (G8B43_03465) | - | 665349..666491 (-) | 1143 | WP_003051793.1 | site-specific integrase | - |
| G8B43_RS03455 (G8B43_03470) | - | 666615..667133 (-) | 519 | WP_011528799.1 | HIRAN domain-containing protein | - |
| G8B43_RS03460 (G8B43_03475) | - | 667145..667900 (-) | 756 | WP_010922480.1 | XRE family transcriptional regulator | - |
| G8B43_RS03465 (G8B43_03480) | - | 668102..668314 (+) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| G8B43_RS03470 (G8B43_03485) | - | 668584..668895 (+) | 312 | WP_010922478.1 | excisionase | - |
| G8B43_RS03475 (G8B43_03490) | - | 668897..669082 (+) | 186 | WP_010922477.1 | hypothetical protein | - |
| G8B43_RS09805 | - | 669176..669445 (+) | 270 | WP_011106700.1 | replication protein | - |
| G8B43_RS03480 (G8B43_03495) | - | 669571..669957 (+) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| G8B43_RS03485 (G8B43_03500) | - | 669938..670171 (+) | 234 | WP_010922205.1 | hypothetical protein | - |
| G8B43_RS03490 (G8B43_03505) | - | 670168..670308 (+) | 141 | WP_129328330.1 | hypothetical protein | - |
| G8B43_RS03495 (G8B43_03510) | - | 670317..670523 (+) | 207 | WP_002988357.1 | hypothetical protein | - |
| G8B43_RS03500 (G8B43_03515) | - | 670579..670908 (+) | 330 | WP_011528796.1 | hypothetical protein | - |
| G8B43_RS03505 (G8B43_03520) | - | 670911..671832 (+) | 922 | Protein_632 | recombinase RecT | - |
| G8B43_RS03510 (G8B43_03525) | - | 671829..672029 (+) | 201 | WP_000594115.1 | hypothetical protein | - |
| G8B43_RS03515 (G8B43_03530) | - | 672022..672819 (+) | 798 | WP_011054699.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| G8B43_RS03520 (G8B43_03535) | - | 673184..673579 (+) | 396 | WP_011054698.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| G8B43_RS03525 (G8B43_03540) | - | 673576..674922 (+) | 1347 | WP_011054697.1 | PcfJ domain-containing protein | - |
| G8B43_RS03530 (G8B43_03545) | - | 674933..675265 (+) | 333 | WP_011184741.1 | hypothetical protein | - |
| G8B43_RS03535 (G8B43_03550) | - | 675262..675774 (+) | 513 | WP_011054695.1 | hypothetical protein | - |
| G8B43_RS03540 (G8B43_03555) | - | 675810..676127 (+) | 318 | WP_011054694.1 | DUF1372 family protein | - |
| G8B43_RS03545 (G8B43_03560) | - | 676124..676279 (+) | 156 | WP_011054693.1 | hypothetical protein | - |
| G8B43_RS03550 (G8B43_03565) | - | 676276..676527 (+) | 252 | WP_011054692.1 | hypothetical protein | - |
| G8B43_RS03555 (G8B43_03570) | - | 676603..677022 (+) | 420 | WP_011528791.1 | DUF1492 domain-containing protein | - |
| G8B43_RS03560 (G8B43_03575) | - | 677130..677474 (+) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| G8B43_RS03565 (G8B43_03580) | - | 677622..677978 (+) | 357 | WP_002994106.1 | hypothetical protein | - |
| G8B43_RS03570 (G8B43_03585) | - | 677975..679243 (+) | 1269 | WP_010922468.1 | phage portal protein | - |
| G8B43_RS03575 (G8B43_03590) | - | 679236..680729 (+) | 1494 | WP_010922467.1 | hypothetical protein | - |
| G8B43_RS03580 (G8B43_03595) | - | 680735..680959 (+) | 225 | WP_002994100.1 | hypothetical protein | - |
| G8B43_RS03585 (G8B43_03600) | - | 681011..681277 (+) | 267 | WP_011054745.1 | hypothetical protein | - |
| G8B43_RS03590 (G8B43_03605) | - | 681279..681515 (+) | 237 | Protein_649 | hypothetical protein | - |
| G8B43_RS03595 (G8B43_03610) | - | 681597..683012 (+) | 1416 | WP_021299324.1 | phage terminase large subunit-like protein | - |
| G8B43_RS03600 (G8B43_03615) | - | 683092..683553 (+) | 462 | WP_010922462.1 | DUF4355 domain-containing protein | - |
| G8B43_RS03605 (G8B43_03620) | - | 683578..684489 (+) | 912 | WP_011528788.1 | phage major capsid protein | - |
| G8B43_RS03610 (G8B43_03625) | - | 684489..684689 (+) | 201 | WP_010922460.1 | hypothetical protein | - |
| G8B43_RS03615 (G8B43_03630) | - | 684699..685121 (+) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| G8B43_RS03620 (G8B43_03635) | - | 685081..685419 (+) | 339 | WP_011054681.1 | hypothetical protein | - |
| G8B43_RS03625 (G8B43_03640) | - | 685412..685648 (+) | 237 | WP_219227109.1 | hypothetical protein | - |
| G8B43_RS03630 (G8B43_03645) | - | 685649..685984 (+) | 336 | WP_011528787.1 | hypothetical protein | - |
| G8B43_RS03635 (G8B43_03650) | - | 685996..686574 (+) | 579 | WP_014635577.1 | hypothetical protein | - |
| G8B43_RS03640 (G8B43_03655) | - | 686585..686848 (+) | 264 | WP_003047548.1 | hypothetical protein | - |
| G8B43_RS03645 (G8B43_03660) | - | 686863..687234 (+) | 372 | WP_011528785.1 | DUF5361 domain-containing protein | - |
| G8B43_RS03650 (G8B43_03665) | - | 687234..689591 (+) | 2358 | WP_011528784.1 | hypothetical protein | - |
| G8B43_RS03655 (G8B43_03670) | - | 689588..690283 (+) | 696 | WP_002992579.1 | hypothetical protein | - |
| G8B43_RS03660 (G8B43_03675) | - | 690265..692241 (+) | 1977 | WP_011528783.1 | phage tail spike protein | - |
| G8B43_RS03665 (G8B43_03680) | hylP | 692238..693353 (+) | 1116 | WP_011528782.1 | hyaluronoglucosaminidase | - |
| G8B43_RS03670 (G8B43_03685) | - | 693368..695149 (+) | 1782 | WP_011528781.1 | gp58-like family protein | - |
| G8B43_RS03675 (G8B43_03690) | - | 695158..695586 (+) | 429 | WP_011528780.1 | DUF1617 family protein | - |
| G8B43_RS03680 (G8B43_03695) | - | 695589..696221 (+) | 633 | WP_011528779.1 | hypothetical protein | - |
| G8B43_RS03685 (G8B43_03700) | - | 696233..696505 (+) | 273 | WP_011017397.1 | hypothetical protein | - |
| G8B43_RS03690 (G8B43_03705) | - | 696502..696729 (+) | 228 | WP_003058873.1 | phage holin | - |
| G8B43_RS03695 (G8B43_03710) | - | 696848..698065 (+) | 1218 | WP_011528778.1 | peptidoglycan amidohydrolase family protein | - |
| G8B43_RS03700 (G8B43_03715) | - | 698201..699325 (+) | 1125 | WP_002988467.1 | Fic family protein | - |
| G8B43_RS03705 (G8B43_03720) | entC3 | 699573..700355 (+) | 783 | WP_002988472.1 | enterotoxin type C3 EntC3 | - |
| G8B43_RS03710 (G8B43_03725) | prx | 700468..700650 (+) | 183 | WP_011528776.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6840.81 Da Isoelectric Point: 4.7023
>NTDB_id=426809 G8B43_RS03710 WP_011528776.1 700468..700650(+) (prx) [Streptococcus pyogenes strain ABC221]
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=426809 G8B43_RS03710 WP_011528776.1 700468..700650(+) (prx) [Streptococcus pyogenes strain ABC221]
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
81.395 |
71.667 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |