Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | G8B44_RS03400 | Genome accession | NZ_CP049688 |
| Coordinates | 659086..659268 (+) | Length | 60 a.a. |
| NCBI ID | WP_011528776.1 | Uniprot ID | A0A660A5W9 |
| Organism | Streptococcus pyogenes strain ABC245 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 623602..659268 | 659086..659268 | within | 0 |
Gene organization within MGE regions
Location: 623602..659268
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G8B44_RS03135 (G8B44_03150) | - | 623602..623877 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| G8B44_RS03140 (G8B44_03155) | - | 623966..625108 (-) | 1143 | WP_003051793.1 | site-specific integrase | - |
| G8B44_RS03145 (G8B44_03160) | - | 625232..625750 (-) | 519 | WP_011528799.1 | HIRAN domain-containing protein | - |
| G8B44_RS03150 (G8B44_03165) | - | 625762..626517 (-) | 756 | WP_010922480.1 | XRE family transcriptional regulator | - |
| G8B44_RS03155 (G8B44_03170) | - | 626719..626931 (+) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| G8B44_RS03160 (G8B44_03175) | - | 627201..627512 (+) | 312 | WP_010922478.1 | excisionase | - |
| G8B44_RS03165 (G8B44_03180) | - | 627514..627699 (+) | 186 | WP_010922477.1 | hypothetical protein | - |
| G8B44_RS09470 | - | 627793..628062 (+) | 270 | WP_011106700.1 | replication protein | - |
| G8B44_RS03170 (G8B44_03185) | - | 628188..628574 (+) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| G8B44_RS03175 (G8B44_03190) | - | 628555..628789 (+) | 235 | Protein_566 | hypothetical protein | - |
| G8B44_RS03180 (G8B44_03195) | - | 628786..628926 (+) | 141 | WP_002988354.1 | hypothetical protein | - |
| G8B44_RS03185 (G8B44_03200) | - | 628935..629141 (+) | 207 | WP_002988357.1 | hypothetical protein | - |
| G8B44_RS03190 (G8B44_03205) | - | 629197..629526 (+) | 330 | WP_011528796.1 | hypothetical protein | - |
| G8B44_RS03195 (G8B44_03210) | - | 629529..630450 (+) | 922 | Protein_570 | recombinase RecT | - |
| G8B44_RS03200 (G8B44_03215) | - | 630447..630647 (+) | 201 | WP_000594115.1 | hypothetical protein | - |
| G8B44_RS03205 (G8B44_03220) | - | 630640..631437 (+) | 798 | WP_011054699.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| G8B44_RS03210 (G8B44_03225) | - | 631802..632197 (+) | 396 | WP_011054698.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| G8B44_RS03215 (G8B44_03230) | - | 632194..633540 (+) | 1347 | WP_011054697.1 | PcfJ domain-containing protein | - |
| G8B44_RS03220 (G8B44_03235) | - | 633551..633883 (+) | 333 | WP_011184741.1 | hypothetical protein | - |
| G8B44_RS03225 (G8B44_03240) | - | 633880..634392 (+) | 513 | WP_011054695.1 | hypothetical protein | - |
| G8B44_RS03230 (G8B44_03245) | - | 634428..634745 (+) | 318 | WP_011054694.1 | DUF1372 family protein | - |
| G8B44_RS03235 (G8B44_03250) | - | 634742..634897 (+) | 156 | WP_011054693.1 | hypothetical protein | - |
| G8B44_RS03240 (G8B44_03255) | - | 634894..635145 (+) | 252 | WP_011054692.1 | hypothetical protein | - |
| G8B44_RS03245 (G8B44_03260) | - | 635221..635640 (+) | 420 | WP_011528791.1 | DUF1492 domain-containing protein | - |
| G8B44_RS03250 (G8B44_03265) | - | 635748..636092 (+) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| G8B44_RS03255 (G8B44_03270) | - | 636240..636596 (+) | 357 | WP_002994106.1 | hypothetical protein | - |
| G8B44_RS03260 (G8B44_03275) | - | 636593..637861 (+) | 1269 | WP_010922468.1 | phage portal protein | - |
| G8B44_RS03265 (G8B44_03280) | - | 637854..639347 (+) | 1494 | WP_010922467.1 | hypothetical protein | - |
| G8B44_RS03270 (G8B44_03285) | - | 639353..639577 (+) | 225 | WP_002994100.1 | hypothetical protein | - |
| G8B44_RS03275 (G8B44_03290) | - | 639629..639895 (+) | 267 | WP_011054745.1 | hypothetical protein | - |
| G8B44_RS03280 (G8B44_03295) | - | 639897..640133 (+) | 237 | Protein_587 | hypothetical protein | - |
| G8B44_RS03285 (G8B44_03300) | - | 640215..641630 (+) | 1416 | WP_021299324.1 | phage terminase large subunit-like protein | - |
| G8B44_RS03290 (G8B44_03305) | - | 641710..642171 (+) | 462 | WP_010922462.1 | DUF4355 domain-containing protein | - |
| G8B44_RS03295 (G8B44_03310) | - | 642196..643107 (+) | 912 | WP_011528788.1 | phage major capsid protein | - |
| G8B44_RS03300 (G8B44_03315) | - | 643107..643307 (+) | 201 | WP_010922460.1 | hypothetical protein | - |
| G8B44_RS03305 (G8B44_03320) | - | 643317..643739 (+) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| G8B44_RS03310 (G8B44_03325) | - | 643699..644037 (+) | 339 | WP_011054681.1 | hypothetical protein | - |
| G8B44_RS03315 (G8B44_03330) | - | 644030..644266 (+) | 237 | WP_000032787.1 | hypothetical protein | - |
| G8B44_RS03320 (G8B44_03335) | - | 644267..644602 (+) | 336 | WP_011528787.1 | hypothetical protein | - |
| G8B44_RS03325 (G8B44_03340) | - | 644614..645192 (+) | 579 | WP_014635577.1 | hypothetical protein | - |
| G8B44_RS03330 (G8B44_03345) | - | 645203..645466 (+) | 264 | WP_003047548.1 | hypothetical protein | - |
| G8B44_RS03335 (G8B44_03350) | - | 645481..645852 (+) | 372 | WP_011528785.1 | DUF5361 domain-containing protein | - |
| G8B44_RS03340 (G8B44_03355) | - | 645852..648209 (+) | 2358 | WP_011528784.1 | hypothetical protein | - |
| G8B44_RS03345 (G8B44_03360) | - | 648206..648901 (+) | 696 | WP_002992579.1 | hypothetical protein | - |
| G8B44_RS03350 (G8B44_03365) | - | 648883..650859 (+) | 1977 | WP_011528783.1 | phage tail spike protein | - |
| G8B44_RS03355 (G8B44_03370) | hylP | 650856..651971 (+) | 1116 | WP_011528782.1 | hyaluronoglucosaminidase | - |
| G8B44_RS03360 (G8B44_03375) | - | 651986..653767 (+) | 1782 | WP_011528781.1 | gp58-like family protein | - |
| G8B44_RS03365 (G8B44_03380) | - | 653776..654204 (+) | 429 | WP_011528780.1 | DUF1617 family protein | - |
| G8B44_RS03370 (G8B44_03385) | - | 654207..654839 (+) | 633 | WP_011528779.1 | hypothetical protein | - |
| G8B44_RS03375 (G8B44_03390) | - | 654851..655123 (+) | 273 | WP_011017397.1 | hypothetical protein | - |
| G8B44_RS03380 (G8B44_03395) | - | 655120..655347 (+) | 228 | WP_003058873.1 | phage holin | - |
| G8B44_RS03385 (G8B44_03400) | - | 655466..656683 (+) | 1218 | WP_011528778.1 | peptidoglycan amidohydrolase family protein | - |
| G8B44_RS03390 (G8B44_03405) | - | 656819..657943 (+) | 1125 | WP_002988467.1 | Fic family protein | - |
| G8B44_RS03395 (G8B44_03410) | entC3 | 658191..658973 (+) | 783 | WP_002988472.1 | enterotoxin type C3 EntC3 | - |
| G8B44_RS03400 (G8B44_03415) | prx | 659086..659268 (+) | 183 | WP_011528776.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6840.81 Da Isoelectric Point: 4.7023
>NTDB_id=426752 G8B44_RS03400 WP_011528776.1 659086..659268(+) (prx) [Streptococcus pyogenes strain ABC245]
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=426752 G8B44_RS03400 WP_011528776.1 659086..659268(+) (prx) [Streptococcus pyogenes strain ABC245]
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
81.395 |
71.667 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |