Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | G8B45_RS06120 | Genome accession | NZ_CP049687 |
| Coordinates | 1216099..1216281 (-) | Length | 60 a.a. |
| NCBI ID | WP_011528776.1 | Uniprot ID | A0A660A5W9 |
| Organism | Streptococcus pyogenes strain TSPY515 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1216099..1244402 | 1216099..1216281 | within | 0 |
Gene organization within MGE regions
Location: 1216099..1244402
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G8B45_RS06120 (G8B45_06165) | prx | 1216099..1216281 (-) | 183 | WP_011528776.1 | hypothetical protein | Regulator |
| G8B45_RS06125 (G8B45_06170) | entC3 | 1216394..1217176 (-) | 783 | WP_002988472.1 | enterotoxin type C3 EntC3 | - |
| G8B45_RS06130 (G8B45_06175) | - | 1217424..1218548 (-) | 1125 | WP_002988467.1 | Fic family protein | - |
| G8B45_RS06135 (G8B45_06180) | - | 1218684..1219901 (-) | 1218 | WP_011528778.1 | peptidoglycan amidohydrolase family protein | - |
| G8B45_RS06140 (G8B45_06185) | - | 1220020..1220247 (-) | 228 | WP_003058873.1 | phage holin | - |
| G8B45_RS06145 (G8B45_06190) | - | 1220244..1220516 (-) | 273 | WP_011017397.1 | hypothetical protein | - |
| G8B45_RS06150 (G8B45_06195) | - | 1220528..1221160 (-) | 633 | WP_011528779.1 | hypothetical protein | - |
| G8B45_RS06155 (G8B45_06200) | - | 1221163..1221591 (-) | 429 | WP_011528780.1 | DUF1617 family protein | - |
| G8B45_RS06160 (G8B45_06205) | - | 1221600..1223381 (-) | 1782 | WP_011528781.1 | gp58-like family protein | - |
| G8B45_RS06165 (G8B45_06210) | hylP | 1223396..1224511 (-) | 1116 | WP_011528782.1 | hyaluronoglucosaminidase | - |
| G8B45_RS06170 (G8B45_06215) | - | 1224508..1226484 (-) | 1977 | WP_011528783.1 | phage tail spike protein | - |
| G8B45_RS06175 (G8B45_06220) | - | 1226466..1227161 (-) | 696 | WP_002992579.1 | hypothetical protein | - |
| G8B45_RS06180 (G8B45_06225) | - | 1227158..1229515 (-) | 2358 | WP_011528784.1 | hypothetical protein | - |
| G8B45_RS06185 (G8B45_06230) | - | 1229515..1229886 (-) | 372 | WP_011528785.1 | DUF5361 domain-containing protein | - |
| G8B45_RS06190 (G8B45_06235) | - | 1229901..1230164 (-) | 264 | WP_003047548.1 | hypothetical protein | - |
| G8B45_RS06195 (G8B45_06240) | - | 1230175..1230753 (-) | 579 | WP_014635577.1 | hypothetical protein | - |
| G8B45_RS06205 (G8B45_06250) | - | 1230877..1231212 (-) | 336 | WP_011528787.1 | hypothetical protein | - |
| G8B45_RS06210 (G8B45_06255) | - | 1231213..1231449 (-) | 237 | WP_000032787.1 | hypothetical protein | - |
| G8B45_RS06215 (G8B45_06260) | - | 1231442..1231779 (-) | 338 | Protein_1184 | hypothetical protein | - |
| G8B45_RS06220 (G8B45_06265) | - | 1231739..1232161 (-) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| G8B45_RS06225 (G8B45_06270) | - | 1232171..1232371 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| G8B45_RS06230 (G8B45_06275) | - | 1232371..1233282 (-) | 912 | WP_011528788.1 | phage major capsid protein | - |
| G8B45_RS06235 (G8B45_06280) | - | 1233307..1233768 (-) | 462 | WP_010922462.1 | DUF4355 domain-containing protein | - |
| G8B45_RS06240 (G8B45_06285) | - | 1233848..1235263 (-) | 1416 | WP_021299324.1 | phage terminase large subunit-like protein | - |
| G8B45_RS06245 (G8B45_06290) | - | 1235345..1235581 (-) | 237 | Protein_1190 | hypothetical protein | - |
| G8B45_RS06250 (G8B45_06295) | - | 1235583..1235849 (-) | 267 | WP_011054745.1 | hypothetical protein | - |
| G8B45_RS06255 (G8B45_06300) | - | 1235901..1236125 (-) | 225 | WP_002994100.1 | hypothetical protein | - |
| G8B45_RS06260 (G8B45_06305) | - | 1236131..1237624 (-) | 1494 | WP_010922467.1 | hypothetical protein | - |
| G8B45_RS06265 (G8B45_06310) | - | 1237617..1238885 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| G8B45_RS06270 (G8B45_06315) | - | 1238882..1239238 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| G8B45_RS06275 (G8B45_06320) | - | 1239386..1239730 (-) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| G8B45_RS06280 (G8B45_06325) | - | 1239838..1240257 (-) | 420 | WP_011528791.1 | DUF1492 domain-containing protein | - |
| G8B45_RS06285 (G8B45_06330) | - | 1240436..1240763 (-) | 328 | Protein_1198 | recombinase RecT | - |
| G8B45_RS06290 (G8B45_06335) | - | 1240766..1241095 (-) | 330 | WP_011528796.1 | hypothetical protein | - |
| G8B45_RS06295 (G8B45_06340) | - | 1241151..1241357 (-) | 207 | WP_002988357.1 | hypothetical protein | - |
| G8B45_RS06300 (G8B45_06345) | - | 1241366..1241506 (-) | 141 | WP_002988354.1 | hypothetical protein | - |
| G8B45_RS06305 (G8B45_06350) | - | 1241503..1241737 (-) | 235 | Protein_1202 | hypothetical protein | - |
| G8B45_RS06310 | - | 1241718..1241921 (-) | 204 | Protein_1203 | DNA replication protein | - |
| G8B45_RS06315 (G8B45_06360) | - | 1241918..1242514 (+) | 597 | Protein_1204 | tyrosine-type recombinase/integrase | - |
| G8B45_RS06320 (G8B45_06365) | - | 1242603..1242878 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| G8B45_RS06325 (G8B45_06370) | - | 1242977..1243564 (-) | 588 | WP_002989129.1 | YpmS family protein | - |
| G8B45_RS06330 (G8B45_06375) | - | 1243542..1244384 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6840.81 Da Isoelectric Point: 4.7023
>NTDB_id=426706 G8B45_RS06120 WP_011528776.1 1216099..1216281(-) (prx) [Streptococcus pyogenes strain TSPY515]
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=426706 G8B45_RS06120 WP_011528776.1 1216099..1216281(-) (prx) [Streptococcus pyogenes strain TSPY515]
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
81.395 |
71.667 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |