Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | G8B46_RS05815 | Genome accession | NZ_CP049686 |
| Coordinates | 1173475..1173657 (-) | Length | 60 a.a. |
| NCBI ID | WP_011528776.1 | Uniprot ID | A0A660A5W9 |
| Organism | Streptococcus pyogenes strain TSPY637 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1173475..1201778 | 1173475..1173657 | within | 0 |
Gene organization within MGE regions
Location: 1173475..1201778
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G8B46_RS05815 (G8B46_05860) | prx | 1173475..1173657 (-) | 183 | WP_011528776.1 | hypothetical protein | Regulator |
| G8B46_RS05820 (G8B46_05865) | entC3 | 1173770..1174552 (-) | 783 | WP_002988472.1 | enterotoxin type C3 EntC3 | - |
| G8B46_RS05825 (G8B46_05870) | - | 1174800..1175924 (-) | 1125 | WP_002988467.1 | Fic family protein | - |
| G8B46_RS05830 (G8B46_05875) | - | 1176060..1177277 (-) | 1218 | WP_011528778.1 | peptidoglycan amidohydrolase family protein | - |
| G8B46_RS05835 (G8B46_05880) | - | 1177396..1177623 (-) | 228 | WP_003058873.1 | phage holin | - |
| G8B46_RS05840 (G8B46_05885) | - | 1177620..1177892 (-) | 273 | WP_011017397.1 | hypothetical protein | - |
| G8B46_RS05845 (G8B46_05890) | - | 1177904..1178536 (-) | 633 | WP_011528779.1 | hypothetical protein | - |
| G8B46_RS05850 (G8B46_05895) | - | 1178539..1178967 (-) | 429 | WP_011528780.1 | DUF1617 family protein | - |
| G8B46_RS05855 (G8B46_05900) | - | 1178976..1180757 (-) | 1782 | WP_011528781.1 | gp58-like family protein | - |
| G8B46_RS05860 (G8B46_05905) | hylP | 1180772..1181887 (-) | 1116 | WP_011528782.1 | hyaluronoglucosaminidase | - |
| G8B46_RS05865 (G8B46_05910) | - | 1181884..1183860 (-) | 1977 | WP_011528783.1 | phage tail spike protein | - |
| G8B46_RS05870 (G8B46_05915) | - | 1183842..1184537 (-) | 696 | WP_002992579.1 | hypothetical protein | - |
| G8B46_RS05875 (G8B46_05920) | - | 1184534..1186891 (-) | 2358 | WP_011528784.1 | hypothetical protein | - |
| G8B46_RS05880 (G8B46_05925) | - | 1186891..1187262 (-) | 372 | WP_011528785.1 | DUF5361 domain-containing protein | - |
| G8B46_RS05885 (G8B46_05930) | - | 1187277..1187540 (-) | 264 | WP_003047548.1 | hypothetical protein | - |
| G8B46_RS05890 (G8B46_05935) | - | 1187551..1188129 (-) | 579 | WP_014635577.1 | hypothetical protein | - |
| G8B46_RS05900 (G8B46_05945) | - | 1188253..1188588 (-) | 336 | WP_011528787.1 | hypothetical protein | - |
| G8B46_RS05905 (G8B46_05950) | - | 1188589..1188825 (-) | 237 | WP_000032787.1 | hypothetical protein | - |
| G8B46_RS05910 (G8B46_05955) | - | 1188818..1189155 (-) | 338 | Protein_1123 | hypothetical protein | - |
| G8B46_RS05915 (G8B46_05960) | - | 1189115..1189537 (-) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| G8B46_RS05920 (G8B46_05965) | - | 1189547..1189747 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| G8B46_RS05925 (G8B46_05970) | - | 1189747..1190658 (-) | 912 | WP_011528788.1 | phage major capsid protein | - |
| G8B46_RS05930 (G8B46_05975) | - | 1190683..1191144 (-) | 462 | WP_010922462.1 | DUF4355 domain-containing protein | - |
| G8B46_RS05935 (G8B46_05980) | - | 1191224..1192639 (-) | 1416 | WP_021299324.1 | phage terminase large subunit-like protein | - |
| G8B46_RS05940 (G8B46_05985) | - | 1192721..1192957 (-) | 237 | Protein_1129 | hypothetical protein | - |
| G8B46_RS05945 (G8B46_05990) | - | 1192959..1193225 (-) | 267 | WP_011054745.1 | hypothetical protein | - |
| G8B46_RS05950 (G8B46_05995) | - | 1193277..1193501 (-) | 225 | WP_002994100.1 | hypothetical protein | - |
| G8B46_RS05955 (G8B46_06000) | - | 1193507..1195000 (-) | 1494 | WP_010922467.1 | hypothetical protein | - |
| G8B46_RS05960 (G8B46_06005) | - | 1194993..1196261 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| G8B46_RS05965 (G8B46_06010) | - | 1196258..1196614 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| G8B46_RS05970 (G8B46_06015) | - | 1196762..1197106 (-) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| G8B46_RS05975 (G8B46_06020) | - | 1197214..1197633 (-) | 420 | WP_011528791.1 | DUF1492 domain-containing protein | - |
| G8B46_RS05980 (G8B46_06025) | - | 1197812..1198139 (-) | 328 | Protein_1137 | recombinase RecT | - |
| G8B46_RS05985 (G8B46_06030) | - | 1198142..1198471 (-) | 330 | WP_011528796.1 | hypothetical protein | - |
| G8B46_RS05990 (G8B46_06035) | - | 1198527..1198733 (-) | 207 | WP_002988357.1 | hypothetical protein | - |
| G8B46_RS05995 (G8B46_06040) | - | 1198742..1198882 (-) | 141 | WP_002988354.1 | hypothetical protein | - |
| G8B46_RS06000 (G8B46_06045) | - | 1198879..1199113 (-) | 235 | Protein_1141 | hypothetical protein | - |
| G8B46_RS06005 | - | 1199094..1199297 (-) | 204 | Protein_1142 | DNA replication protein | - |
| G8B46_RS06010 (G8B46_06055) | - | 1199294..1199890 (+) | 597 | Protein_1143 | tyrosine-type recombinase/integrase | - |
| G8B46_RS06015 (G8B46_06060) | - | 1199979..1200254 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| G8B46_RS06020 (G8B46_06065) | - | 1200353..1200940 (-) | 588 | WP_002989129.1 | YpmS family protein | - |
| G8B46_RS06025 (G8B46_06070) | - | 1200918..1201760 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6840.81 Da Isoelectric Point: 4.7023
>NTDB_id=426650 G8B46_RS05815 WP_011528776.1 1173475..1173657(-) (prx) [Streptococcus pyogenes strain TSPY637]
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=426650 G8B46_RS05815 WP_011528776.1 1173475..1173657(-) (prx) [Streptococcus pyogenes strain TSPY637]
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
81.395 |
71.667 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |