Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | G8B46_RS04060 | Genome accession | NZ_CP049686 |
| Coordinates | 794132..794320 (+) | Length | 62 a.a. |
| NCBI ID | WP_011528571.1 | Uniprot ID | A0A660A3N3 |
| Organism | Streptococcus pyogenes strain TSPY637 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 772342..794320 | 794132..794320 | within | 0 |
Gene organization within MGE regions
Location: 772342..794320
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G8B46_RS03920 (G8B46_03955) | - | 772342..772935 (+) | 594 | WP_002990099.1 | dTDP-4-dehydrorhamnose 3,5-epimerase family protein | - |
| G8B46_RS03925 (G8B46_03960) | rfbB | 773179..774219 (+) | 1041 | WP_002984881.1 | dTDP-glucose 4,6-dehydratase | - |
| G8B46_RS03930 (G8B46_03965) | - | 774302..775237 (-) | 936 | WP_060388510.1 | site-specific integrase | - |
| G8B46_RS03935 (G8B46_03970) | - | 775384..775704 (+) | 321 | WP_002995960.1 | VRR-NUC domain-containing protein | - |
| G8B46_RS03940 (G8B46_03975) | - | 775688..776044 (+) | 357 | WP_011018138.1 | hypothetical protein | - |
| G8B46_RS09130 | - | 776041..776292 (+) | 252 | WP_011528549.1 | hypothetical protein | - |
| G8B46_RS03945 (G8B46_03980) | - | 776301..776510 (+) | 210 | Protein_734 | DUF4355 domain-containing protein | - |
| G8B46_RS03950 (G8B46_03985) | - | 776529..777419 (+) | 891 | WP_011528556.1 | hypothetical protein | - |
| G8B46_RS03955 (G8B46_03990) | - | 777431..777724 (+) | 294 | WP_011528557.1 | HeH/LEM domain-containing protein | - |
| G8B46_RS03960 (G8B46_03995) | - | 777738..778082 (+) | 345 | WP_060388512.1 | hypothetical protein | - |
| G8B46_RS03965 (G8B46_04000) | - | 778079..778390 (+) | 312 | WP_011528559.1 | hypothetical protein | - |
| G8B46_RS03970 (G8B46_04005) | - | 778387..778782 (+) | 396 | WP_011528560.1 | hypothetical protein | - |
| G8B46_RS03975 (G8B46_04010) | - | 778784..779194 (+) | 411 | WP_011528561.1 | DUF5072 family protein | - |
| G8B46_RS03980 (G8B46_04015) | - | 779209..779463 (+) | 255 | WP_231494232.1 | phage major tail protein, TP901-1 family | - |
| G8B46_RS03985 (G8B46_04020) | - | 779476..779766 (+) | 291 | WP_060388513.1 | hypothetical protein | - |
| G8B46_RS03990 (G8B46_04025) | - | 779723..781300 (+) | 1578 | WP_231494234.1 | phage tail protein | - |
| G8B46_RS03995 (G8B46_04030) | - | 781301..782785 (+) | 1485 | WP_011528566.1 | distal tail protein Dit | - |
| G8B46_RS04000 (G8B46_04035) | - | 782786..786235 (+) | 3450 | WP_011528567.1 | glucosaminidase domain-containing protein | - |
| G8B46_RS04005 (G8B46_04040) | - | 786240..788102 (+) | 1863 | WP_011528568.1 | DUF859 family phage minor structural protein | - |
| G8B46_RS04010 (G8B46_04045) | - | 788113..788460 (+) | 348 | WP_009880247.1 | DUF1366 domain-containing protein | - |
| G8B46_RS09040 | - | 788474..788596 (+) | 123 | WP_015055953.1 | hypothetical protein | - |
| G8B46_RS04015 (G8B46_04050) | - | 788610..788933 (+) | 324 | WP_015055952.1 | hypothetical protein | - |
| G8B46_RS04020 (G8B46_04055) | - | 788933..789265 (+) | 333 | WP_011054798.1 | phage holin | - |
| G8B46_RS04025 (G8B46_04060) | - | 789267..790031 (+) | 765 | WP_011054797.1 | CHAP domain-containing protein | - |
| G8B46_RS04030 (G8B46_04065) | - | 790043..790645 (+) | 603 | WP_011054796.1 | hypothetical protein | - |
| G8B46_RS04035 (G8B46_04070) | - | 790656..791429 (+) | 774 | WP_011528569.1 | hypothetical protein | - |
| G8B46_RS04040 (G8B46_04075) | - | 791439..791660 (+) | 222 | WP_009880241.1 | hypothetical protein | - |
| G8B46_RS04045 (G8B46_04080) | - | 791660..792319 (+) | 660 | WP_011528570.1 | hypothetical protein | - |
| G8B46_RS04050 (G8B46_04085) | - | 792388..792822 (-) | 435 | WP_011017966.1 | hypothetical protein | - |
| G8B46_RS04055 (G8B46_04090) | sda3 | 793094..793894 (-) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| G8B46_RS04060 (G8B46_04095) | prx | 794132..794320 (+) | 189 | WP_011528571.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7224.11 Da Isoelectric Point: 4.0606
>NTDB_id=426644 G8B46_RS04060 WP_011528571.1 794132..794320(+) (prx) [Streptococcus pyogenes strain TSPY637]
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
Nucleotide
Download Length: 189 bp
>NTDB_id=426644 G8B46_RS04060 WP_011528571.1 794132..794320(+) (prx) [Streptococcus pyogenes strain TSPY637]
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
96.774 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
96.774 |
0.694 |
| prx | Streptococcus pyogenes MGAS315 |
90.698 |
69.355 |
0.629 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
66.129 |
0.565 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |