Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | G8B47_RS06100 | Genome accession | NZ_CP049685 |
| Coordinates | 1215720..1215902 (-) | Length | 60 a.a. |
| NCBI ID | WP_011528776.1 | Uniprot ID | A0A660A5W9 |
| Organism | Streptococcus pyogenes strain TSPY806 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1215720..1244023 | 1215720..1215902 | within | 0 |
Gene organization within MGE regions
Location: 1215720..1244023
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G8B47_RS06100 (G8B47_06145) | prx | 1215720..1215902 (-) | 183 | WP_011528776.1 | hypothetical protein | Regulator |
| G8B47_RS06105 (G8B47_06150) | entC3 | 1216015..1216797 (-) | 783 | WP_002988472.1 | enterotoxin type C3 EntC3 | - |
| G8B47_RS06110 (G8B47_06155) | - | 1217045..1218169 (-) | 1125 | WP_002988467.1 | Fic family protein | - |
| G8B47_RS06115 (G8B47_06160) | - | 1218305..1219522 (-) | 1218 | WP_011528778.1 | peptidoglycan amidohydrolase family protein | - |
| G8B47_RS06120 (G8B47_06165) | - | 1219641..1219868 (-) | 228 | WP_003058873.1 | phage holin | - |
| G8B47_RS06125 (G8B47_06170) | - | 1219865..1220137 (-) | 273 | WP_011017397.1 | hypothetical protein | - |
| G8B47_RS06130 (G8B47_06175) | - | 1220149..1220781 (-) | 633 | WP_011528779.1 | hypothetical protein | - |
| G8B47_RS06135 (G8B47_06180) | - | 1220784..1221212 (-) | 429 | WP_011528780.1 | DUF1617 family protein | - |
| G8B47_RS06140 (G8B47_06185) | - | 1221221..1223002 (-) | 1782 | WP_011528781.1 | gp58-like family protein | - |
| G8B47_RS06145 (G8B47_06190) | hylP | 1223017..1224132 (-) | 1116 | WP_011528782.1 | hyaluronoglucosaminidase | - |
| G8B47_RS06150 (G8B47_06195) | - | 1224129..1226105 (-) | 1977 | WP_011528783.1 | phage tail spike protein | - |
| G8B47_RS06155 (G8B47_06200) | - | 1226087..1226782 (-) | 696 | WP_002992579.1 | hypothetical protein | - |
| G8B47_RS06160 (G8B47_06205) | - | 1226779..1229136 (-) | 2358 | WP_011528784.1 | hypothetical protein | - |
| G8B47_RS06165 (G8B47_06210) | - | 1229136..1229507 (-) | 372 | WP_011528785.1 | DUF5361 domain-containing protein | - |
| G8B47_RS06170 (G8B47_06215) | - | 1229522..1229785 (-) | 264 | WP_003047548.1 | hypothetical protein | - |
| G8B47_RS06175 (G8B47_06220) | - | 1229796..1230317 (-) | 522 | WP_372237178.1 | phage tail protein | - |
| G8B47_RS09500 (G8B47_06225) | - | 1230366..1230486 (-) | 121 | Protein_1179 | phage tail protein | - |
| G8B47_RS06185 (G8B47_06230) | - | 1230498..1230833 (-) | 336 | WP_011528787.1 | hypothetical protein | - |
| G8B47_RS06190 (G8B47_06235) | - | 1230834..1231070 (-) | 237 | WP_000032787.1 | hypothetical protein | - |
| G8B47_RS06195 (G8B47_06240) | - | 1231063..1231400 (-) | 338 | Protein_1182 | hypothetical protein | - |
| G8B47_RS06200 (G8B47_06245) | - | 1231360..1231782 (-) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| G8B47_RS06205 (G8B47_06250) | - | 1231792..1231992 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| G8B47_RS06210 (G8B47_06255) | - | 1231992..1232903 (-) | 912 | WP_011528788.1 | phage major capsid protein | - |
| G8B47_RS06215 (G8B47_06260) | - | 1232928..1233389 (-) | 462 | WP_010922462.1 | DUF4355 domain-containing protein | - |
| G8B47_RS06220 (G8B47_06265) | - | 1233469..1234884 (-) | 1416 | WP_021299324.1 | phage terminase large subunit-like protein | - |
| G8B47_RS06225 (G8B47_06270) | - | 1234966..1235202 (-) | 237 | Protein_1188 | hypothetical protein | - |
| G8B47_RS06230 (G8B47_06275) | - | 1235204..1235470 (-) | 267 | WP_011054745.1 | hypothetical protein | - |
| G8B47_RS06235 (G8B47_06280) | - | 1235522..1235746 (-) | 225 | WP_002994100.1 | hypothetical protein | - |
| G8B47_RS06240 (G8B47_06285) | - | 1235752..1237245 (-) | 1494 | WP_010922467.1 | hypothetical protein | - |
| G8B47_RS06245 (G8B47_06290) | - | 1237238..1238506 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| G8B47_RS06250 (G8B47_06295) | - | 1238503..1238859 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| G8B47_RS06255 (G8B47_06300) | - | 1239007..1239351 (-) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| G8B47_RS06260 (G8B47_06305) | - | 1239459..1239878 (-) | 420 | WP_011528791.1 | DUF1492 domain-containing protein | - |
| G8B47_RS06265 (G8B47_06310) | - | 1240057..1240384 (-) | 328 | Protein_1196 | recombinase RecT | - |
| G8B47_RS06270 (G8B47_06315) | - | 1240387..1240716 (-) | 330 | WP_011528796.1 | hypothetical protein | - |
| G8B47_RS06275 (G8B47_06320) | - | 1240772..1240978 (-) | 207 | WP_002988357.1 | hypothetical protein | - |
| G8B47_RS06280 (G8B47_06325) | - | 1240987..1241127 (-) | 141 | WP_002988354.1 | hypothetical protein | - |
| G8B47_RS06285 (G8B47_06330) | - | 1241124..1241358 (-) | 235 | Protein_1200 | hypothetical protein | - |
| G8B47_RS06290 | - | 1241339..1241542 (-) | 204 | Protein_1201 | DNA replication protein | - |
| G8B47_RS06295 (G8B47_06340) | - | 1241539..1242135 (+) | 597 | Protein_1202 | tyrosine-type recombinase/integrase | - |
| G8B47_RS06300 (G8B47_06345) | - | 1242224..1242499 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| G8B47_RS06305 (G8B47_06350) | - | 1242598..1243185 (-) | 588 | WP_002989129.1 | YpmS family protein | - |
| G8B47_RS06310 (G8B47_06355) | - | 1243163..1244005 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6840.81 Da Isoelectric Point: 4.7023
>NTDB_id=426595 G8B47_RS06100 WP_011528776.1 1215720..1215902(-) (prx) [Streptococcus pyogenes strain TSPY806]
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=426595 G8B47_RS06100 WP_011528776.1 1215720..1215902(-) (prx) [Streptococcus pyogenes strain TSPY806]
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
81.395 |
71.667 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |