Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | G8B47_RS04350 | Genome accession | NZ_CP049685 |
| Coordinates | 836017..836205 (+) | Length | 62 a.a. |
| NCBI ID | WP_011528571.1 | Uniprot ID | A0A660A3N3 |
| Organism | Streptococcus pyogenes strain TSPY806 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 814227..842797 | 836017..836205 | within | 0 |
Gene organization within MGE regions
Location: 814227..842797
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G8B47_RS04210 (G8B47_04245) | - | 814227..814820 (+) | 594 | WP_002990099.1 | dTDP-4-dehydrorhamnose 3,5-epimerase family protein | - |
| G8B47_RS04215 (G8B47_04250) | rfbB | 815064..816104 (+) | 1041 | WP_002984881.1 | dTDP-glucose 4,6-dehydratase | - |
| G8B47_RS04220 (G8B47_04255) | - | 816187..817122 (-) | 936 | WP_060388510.1 | site-specific integrase | - |
| G8B47_RS04225 (G8B47_04260) | - | 817269..817589 (+) | 321 | WP_002995960.1 | VRR-NUC domain-containing protein | - |
| G8B47_RS04230 (G8B47_04265) | - | 817573..817929 (+) | 357 | WP_011018138.1 | hypothetical protein | - |
| G8B47_RS09420 | - | 817926..818177 (+) | 252 | WP_011528549.1 | hypothetical protein | - |
| G8B47_RS04235 (G8B47_04270) | - | 818186..818395 (+) | 210 | Protein_792 | DUF4355 domain-containing protein | - |
| G8B47_RS04240 (G8B47_04275) | - | 818414..819304 (+) | 891 | WP_011528556.1 | hypothetical protein | - |
| G8B47_RS04245 (G8B47_04280) | - | 819316..819609 (+) | 294 | WP_011528557.1 | HeH/LEM domain-containing protein | - |
| G8B47_RS04250 (G8B47_04285) | - | 819623..819967 (+) | 345 | WP_060388512.1 | hypothetical protein | - |
| G8B47_RS04255 (G8B47_04290) | - | 819964..820275 (+) | 312 | WP_011528559.1 | hypothetical protein | - |
| G8B47_RS04260 (G8B47_04295) | - | 820272..820667 (+) | 396 | WP_011528560.1 | hypothetical protein | - |
| G8B47_RS04265 (G8B47_04300) | - | 820669..821079 (+) | 411 | WP_011528561.1 | DUF5072 family protein | - |
| G8B47_RS04270 (G8B47_04305) | - | 821094..821348 (+) | 255 | WP_231494232.1 | phage major tail protein, TP901-1 family | - |
| G8B47_RS04275 (G8B47_04310) | - | 821361..821651 (+) | 291 | WP_060388513.1 | hypothetical protein | - |
| G8B47_RS04280 (G8B47_04315) | - | 821608..823185 (+) | 1578 | WP_231494234.1 | phage tail protein | - |
| G8B47_RS04285 (G8B47_04320) | - | 823186..824670 (+) | 1485 | WP_011528566.1 | distal tail protein Dit | - |
| G8B47_RS04290 (G8B47_04325) | - | 824671..828120 (+) | 3450 | WP_011528567.1 | glucosaminidase domain-containing protein | - |
| G8B47_RS04295 (G8B47_04330) | - | 828125..829987 (+) | 1863 | WP_011528568.1 | DUF859 family phage minor structural protein | - |
| G8B47_RS04300 (G8B47_04335) | - | 829998..830345 (+) | 348 | WP_009880247.1 | DUF1366 domain-containing protein | - |
| G8B47_RS09330 | - | 830359..830481 (+) | 123 | WP_015055953.1 | hypothetical protein | - |
| G8B47_RS04305 (G8B47_04340) | - | 830495..830818 (+) | 324 | WP_015055952.1 | hypothetical protein | - |
| G8B47_RS04310 (G8B47_04345) | - | 830818..831150 (+) | 333 | WP_011054798.1 | phage holin | - |
| G8B47_RS04315 (G8B47_04350) | - | 831152..831916 (+) | 765 | WP_011054797.1 | CHAP domain-containing protein | - |
| G8B47_RS04320 (G8B47_04355) | - | 831928..832530 (+) | 603 | WP_011054796.1 | hypothetical protein | - |
| G8B47_RS04325 (G8B47_04360) | - | 832541..833314 (+) | 774 | WP_011528569.1 | hypothetical protein | - |
| G8B47_RS04330 (G8B47_04365) | - | 833324..833545 (+) | 222 | WP_009880241.1 | hypothetical protein | - |
| G8B47_RS04335 (G8B47_04370) | - | 833545..834204 (+) | 660 | WP_011528570.1 | hypothetical protein | - |
| G8B47_RS04340 (G8B47_04375) | - | 834273..834707 (-) | 435 | WP_011017966.1 | hypothetical protein | - |
| G8B47_RS04345 (G8B47_04380) | sda3 | 834979..835779 (-) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| G8B47_RS04350 (G8B47_04385) | prx | 836017..836205 (+) | 189 | WP_011528571.1 | hypothetical protein | Regulator |
| G8B47_RS04355 (G8B47_04390) | - | 836613..837089 (+) | 477 | WP_002984880.1 | 8-oxo-dGTP diphosphatase | - |
| G8B47_RS04360 (G8B47_04395) | - | 837147..838328 (+) | 1182 | WP_002984879.1 | AI-2E family transporter | - |
| G8B47_RS04365 (G8B47_04400) | - | 838318..839565 (+) | 1248 | WP_002984878.1 | tetratricopeptide repeat protein | - |
| G8B47_RS04370 (G8B47_04405) | fbp54 | 839624..841276 (-) | 1653 | WP_021299312.1 | Rqc2 family fibronectin-binding protein Fbp54 | - |
| G8B47_RS04375 (G8B47_04410) | trpX | 841630..842628 (+) | 999 | WP_011184452.1 | tryptophan ABC transporter substrate-binding protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7224.11 Da Isoelectric Point: 4.0606
>NTDB_id=426589 G8B47_RS04350 WP_011528571.1 836017..836205(+) (prx) [Streptococcus pyogenes strain TSPY806]
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
Nucleotide
Download Length: 189 bp
>NTDB_id=426589 G8B47_RS04350 WP_011528571.1 836017..836205(+) (prx) [Streptococcus pyogenes strain TSPY806]
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
96.774 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
96.774 |
0.694 |
| prx | Streptococcus pyogenes MGAS315 |
90.698 |
69.355 |
0.629 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
66.129 |
0.565 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |