Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | G6Z52_RS06625 | Genome accession | NZ_CP049187 |
| Coordinates | 1361221..1361400 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain TSPY1687 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1361221..1401611 | 1361221..1361400 | within | 0 |
Gene organization within MGE regions
Location: 1361221..1401611
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G6Z52_RS06625 (G6Z52_06670) | prx | 1361221..1361400 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| G6Z52_RS06630 (G6Z52_06675) | sda1 | 1361639..1362811 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| G6Z52_RS06635 (G6Z52_06680) | - | 1362927..1364123 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| G6Z52_RS06640 (G6Z52_06685) | - | 1364234..1364419 (-) | 186 | WP_002988802.1 | holin | - |
| G6Z52_RS06645 (G6Z52_06690) | - | 1364416..1364715 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| G6Z52_RS06650 (G6Z52_06695) | - | 1364726..1365346 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| G6Z52_RS06655 (G6Z52_06700) | - | 1365349..1365510 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| G6Z52_RS06660 (G6Z52_06705) | - | 1365519..1367426 (-) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| G6Z52_RS06665 (G6Z52_06710) | - | 1367437..1368072 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| G6Z52_RS06670 (G6Z52_06715) | - | 1368072..1369127 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| G6Z52_RS06675 (G6Z52_06720) | - | 1369124..1371106 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| G6Z52_RS06680 (G6Z52_06725) | - | 1371116..1371958 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| G6Z52_RS06685 (G6Z52_06730) | - | 1371970..1376352 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| G6Z52_RS06690 (G6Z52_06735) | - | 1376367..1376600 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| G6Z52_RS06695 (G6Z52_06740) | - | 1376675..1377130 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| G6Z52_RS06700 (G6Z52_06745) | - | 1377184..1377783 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| G6Z52_RS06705 (G6Z52_06750) | - | 1377795..1378154 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| G6Z52_RS06710 (G6Z52_06755) | - | 1378158..1378502 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| G6Z52_RS06715 (G6Z52_06760) | - | 1378499..1378777 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| G6Z52_RS06720 (G6Z52_06765) | - | 1378788..1379144 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| G6Z52_RS06725 (G6Z52_06770) | - | 1379156..1380043 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| G6Z52_RS06730 (G6Z52_06775) | - | 1380056..1380625 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| G6Z52_RS06735 (G6Z52_06780) | - | 1380781..1381047 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| G6Z52_RS06740 (G6Z52_06785) | - | 1381050..1381238 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| G6Z52_RS06745 (G6Z52_06790) | - | 1381269..1382714 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| G6Z52_RS06750 (G6Z52_06795) | - | 1382674..1384206 (-) | 1533 | WP_002988758.1 | phage portal protein | - |
| G6Z52_RS06755 (G6Z52_06800) | - | 1384222..1385499 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| G6Z52_RS06760 (G6Z52_06805) | - | 1385489..1385941 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| G6Z52_RS06765 (G6Z52_06810) | - | 1386031..1386447 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| G6Z52_RS06770 (G6Z52_06815) | - | 1386444..1386635 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| G6Z52_RS06775 (G6Z52_06820) | - | 1386625..1387476 (-) | 852 | WP_002988740.1 | site-specific DNA-methyltransferase | - |
| G6Z52_RS06780 (G6Z52_06825) | - | 1387485..1387751 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| G6Z52_RS06785 (G6Z52_06830) | - | 1387748..1387915 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| G6Z52_RS06790 (G6Z52_06835) | - | 1387916..1389238 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| G6Z52_RS06795 (G6Z52_06840) | - | 1389235..1389510 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| G6Z52_RS06800 (G6Z52_06845) | - | 1389624..1390487 (-) | 864 | WP_002987985.1 | IS982-like element ISSpy2 family transposase | - |
| G6Z52_RS06805 (G6Z52_06850) | - | 1390866..1393250 (-) | 2385 | WP_002988726.1 | phage/plasmid primase, P4 family | - |
| G6Z52_RS06810 (G6Z52_06855) | - | 1393255..1395177 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| G6Z52_RS06815 (G6Z52_06860) | - | 1395220..1395777 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| G6Z52_RS06820 (G6Z52_06865) | - | 1395788..1396186 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| G6Z52_RS06825 (G6Z52_06870) | - | 1396190..1397344 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| G6Z52_RS06830 (G6Z52_06875) | - | 1397344..1397643 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| G6Z52_RS06835 (G6Z52_06880) | - | 1397731..1397934 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| G6Z52_RS06840 (G6Z52_06885) | - | 1398081..1398467 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| G6Z52_RS06845 (G6Z52_06890) | - | 1398464..1398667 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| G6Z52_RS06850 (G6Z52_06895) | - | 1398660..1398830 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| G6Z52_RS06855 (G6Z52_06900) | - | 1398827..1399102 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| G6Z52_RS06860 (G6Z52_06905) | - | 1399164..1399379 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| G6Z52_RS06865 (G6Z52_06910) | - | 1399427..1399840 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| G6Z52_RS06870 (G6Z52_06915) | - | 1399821..1399976 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| G6Z52_RS06875 (G6Z52_06920) | - | 1400302..1400652 (+) | 351 | WP_002988676.1 | helix-turn-helix transcriptional regulator | - |
| G6Z52_RS06880 (G6Z52_06925) | - | 1400666..1401049 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| G6Z52_RS06885 (G6Z52_06930) | - | 1401060..1401611 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=425302 G6Z52_RS06625 WP_002988813.1 1361221..1361400(-) (prx) [Streptococcus pyogenes strain TSPY1687]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=425302 G6Z52_RS06625 WP_002988813.1 1361221..1361400(-) (prx) [Streptococcus pyogenes strain TSPY1687]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |