Detailed information
Bioinformatically predicted
Overview
| Name | comA | Type | Regulator |
| Locus tag | ST64987_RS10035 | Genome accession | NZ_CP049053 |
| Coordinates | 263503..263712 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain ST64987 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 258503..268712
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ST64987_RS01455 (ST64987_0254) | - | 258912..259451 (+) | 540 | WP_372585740.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| ST64987_RS01460 (ST64987_0255) | - | 259762..260319 (+) | 558 | WP_011680718.1 | ECF transporter S component | - |
| ST64987_RS01465 (ST64987_0256) | - | 260322..260972 (+) | 651 | WP_011680719.1 | phosphatase PAP2 family protein | - |
| ST64987_RS01470 (ST64987_0257) | comR | 261167..262066 (+) | 900 | WP_011680720.1 | helix-turn-helix domain-containing protein | Regulator |
| ST64987_RS09925 | - | 262304..262885 (+) | 582 | Protein_230 | cysteine peptidase family C39 domain-containing protein | - |
| ST64987_RS09930 | comA | 262870..263160 (+) | 291 | WP_194238295.1 | ABC transporter transmembrane domain-containing protein | Regulator |
| ST64987_RS10035 | comA | 263503..263712 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| ST64987_RS10040 (ST64987_0260) | - | 263767..264335 (+) | 569 | Protein_233 | ATP-binding cassette domain-containing protein | - |
| ST64987_RS10045 (ST64987_0261) | - | 264566..264754 (+) | 189 | WP_224103239.1 | hypothetical protein | - |
| ST64987_RS10050 | - | 264722..265006 (-) | 285 | WP_232557103.1 | hypothetical protein | - |
| ST64987_RS10055 | - | 265247..265549 (-) | 303 | WP_224103194.1 | hypothetical protein | - |
| ST64987_RS10060 (ST64987_0262) | - | 265773..266144 (-) | 372 | WP_224103195.1 | hypothetical protein | - |
| ST64987_RS01510 (ST64987_0263) | - | 266549..267064 (+) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| ST64987_RS01515 (ST64987_0264) | - | 267089..267391 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| ST64987_RS01520 (ST64987_0265) | - | 267403..267714 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=424508 ST64987_RS10035 WP_002946147.1 263503..263712(+) (comA) [Streptococcus thermophilus strain ST64987]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=424508 ST64987_RS10035 WP_002946147.1 263503..263712(+) (comA) [Streptococcus thermophilus strain ST64987]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |