Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | E3S75_RS04720 | Genome accession | NZ_CP047798 |
| Coordinates | 938909..939367 (-) | Length | 152 a.a. |
| NCBI ID | WP_160195134.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain UP_378 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 904879..945748 | 938909..939367 | within | 0 |
Gene organization within MGE regions
Location: 904879..945748
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E3S75_RS04480 (E3S75_04480) | - | 904879..905064 (-) | 186 | WP_001286804.1 | hypothetical protein | - |
| E3S75_RS04485 (E3S75_04485) | - | 905066..905176 (-) | 111 | WP_000139423.1 | hypothetical protein | - |
| E3S75_RS04490 (E3S75_04490) | - | 905247..905399 (-) | 153 | WP_001788502.1 | hypothetical protein | - |
| E3S75_RS04495 (E3S75_04495) | - | 905642..907087 (-) | 1446 | WP_001148135.1 | SH3 domain-containing protein | - |
| E3S75_RS04500 (E3S75_04500) | - | 907068..907505 (-) | 438 | WP_031773533.1 | phage holin | - |
| E3S75_RS04505 (E3S75_04505) | - | 907561..907956 (-) | 396 | WP_000398857.1 | hypothetical protein | - |
| E3S75_RS04510 (E3S75_04510) | - | 907961..909199 (-) | 1239 | WP_160195123.1 | BppU family phage baseplate upper protein | - |
| E3S75_RS04515 (E3S75_04515) | - | 909212..911110 (-) | 1899 | WP_160195124.1 | N-acetylglucosaminidase | - |
| E3S75_RS04520 (E3S75_04520) | - | 911247..911546 (-) | 300 | WP_000466777.1 | DUF2951 domain-containing protein | - |
| E3S75_RS04525 (E3S75_04525) | - | 911587..911760 (-) | 174 | WP_015990323.1 | XkdX family protein | - |
| E3S75_RS04530 (E3S75_04530) | - | 911764..912141 (-) | 378 | WP_000705907.1 | DUF2977 domain-containing protein | - |
| E3S75_RS04535 (E3S75_04535) | - | 912141..913964 (-) | 1824 | WP_015967259.1 | phage baseplate upper protein | - |
| E3S75_RS04540 (E3S75_04540) | - | 913964..915874 (-) | 1911 | WP_160195125.1 | hypothetical protein | - |
| E3S75_RS04545 (E3S75_04545) | - | 915889..917790 (-) | 1902 | WP_000156404.1 | SGNH/GDSL hydrolase family protein | - |
| E3S75_RS04550 (E3S75_04550) | - | 917799..918746 (-) | 948 | WP_000350680.1 | phage tail family protein | - |
| E3S75_RS04555 (E3S75_04555) | - | 918759..922223 (-) | 3465 | WP_160195126.1 | hypothetical protein | - |
| E3S75_RS04560 (E3S75_04560) | - | 922240..922584 (-) | 345 | WP_000105584.1 | hypothetical protein | - |
| E3S75_RS04565 (E3S75_04565) | - | 922614..922979 (-) | 366 | WP_001100163.1 | tail assembly chaperone | - |
| E3S75_RS04570 (E3S75_04570) | - | 923041..923622 (-) | 582 | WP_000002576.1 | phage major tail protein, TP901-1 family | - |
| E3S75_RS04575 (E3S75_04575) | - | 923641..924024 (-) | 384 | WP_160195127.1 | hypothetical protein | - |
| E3S75_RS04580 (E3S75_04580) | - | 924036..924383 (-) | 348 | WP_001017815.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| E3S75_RS04585 (E3S75_04585) | - | 924383..924685 (-) | 303 | WP_001268312.1 | hypothetical protein | - |
| E3S75_RS04590 (E3S75_04590) | - | 924682..925014 (-) | 333 | WP_000208960.1 | phage head-tail connector protein | - |
| E3S75_RS04595 (E3S75_04595) | - | 925023..925310 (-) | 288 | WP_001114086.1 | hypothetical protein | - |
| E3S75_RS04600 (E3S75_04600) | - | 925332..926306 (-) | 975 | WP_000438511.1 | phage major capsid protein | - |
| E3S75_RS04605 (E3S75_04605) | - | 926320..926940 (-) | 621 | WP_000392151.1 | DUF4355 domain-containing protein | - |
| E3S75_RS13675 | - | 926934..927021 (-) | 88 | Protein_882 | hypothetical protein | - |
| E3S75_RS04610 (E3S75_04610) | - | 927049..927219 (-) | 171 | WP_000072208.1 | hypothetical protein | - |
| E3S75_RS04615 (E3S75_04615) | - | 927292..928287 (-) | 996 | WP_001133044.1 | minor capsid protein | - |
| E3S75_RS04620 (E3S75_04620) | - | 928294..929829 (-) | 1536 | WP_160195128.1 | phage portal protein | - |
| E3S75_RS04625 (E3S75_04625) | - | 929840..931117 (-) | 1278 | WP_031769002.1 | PBSX family phage terminase large subunit | - |
| E3S75_RS04630 (E3S75_04630) | - | 931104..931544 (-) | 441 | WP_001003271.1 | terminase small subunit | - |
| E3S75_RS04635 (E3S75_04635) | - | 931730..932149 (-) | 420 | WP_000058632.1 | transcriptional regulator | - |
| E3S75_RS04640 (E3S75_04640) | - | 932164..932310 (-) | 147 | WP_160195129.1 | hypothetical protein | - |
| E3S75_RS04645 (E3S75_04645) | rinB | 932311..932484 (-) | 174 | WP_025174872.1 | transcriptional activator RinB | - |
| E3S75_RS04650 (E3S75_04650) | - | 932487..932687 (-) | 201 | WP_160195130.1 | hypothetical protein | - |
| E3S75_RS04655 (E3S75_04655) | - | 932662..932850 (-) | 189 | WP_160195131.1 | DUF1381 domain-containing protein | - |
| E3S75_RS04660 (E3S75_04660) | - | 932887..933417 (-) | 531 | WP_054193490.1 | dUTPase | - |
| E3S75_RS04665 (E3S75_04665) | - | 933410..933658 (-) | 249 | WP_001065068.1 | DUF1024 family protein | - |
| E3S75_RS04670 (E3S75_04670) | - | 933651..934022 (-) | 372 | WP_160195132.1 | acetyltransferase | - |
| E3S75_RS04675 (E3S75_04675) | - | 934031..934273 (-) | 243 | WP_001562543.1 | SAV1978 family virulence-associated passenger protein | - |
| E3S75_RS04680 (E3S75_04680) | - | 934277..934891 (-) | 615 | WP_078371413.1 | SA1788 family PVL leukocidin-associated protein | - |
| E3S75_RS04685 (E3S75_04685) | - | 934892..935077 (-) | 186 | WP_031898213.1 | DUF3113 family protein | - |
| E3S75_RS04690 (E3S75_04690) | - | 935077..935484 (-) | 408 | WP_031898212.1 | RusA family crossover junction endodeoxyribonuclease | - |
| E3S75_RS04695 (E3S75_04695) | - | 935494..935715 (-) | 222 | WP_001123688.1 | DUF3269 family protein | - |
| E3S75_RS13655 | - | 935728..935889 (-) | 162 | WP_000237153.1 | hypothetical protein | - |
| E3S75_RS04700 (E3S75_04700) | - | 935883..936662 (-) | 780 | WP_160195133.1 | ATP-binding protein | - |
| E3S75_RS04705 (E3S75_04705) | - | 936672..937475 (-) | 804 | WP_000504982.1 | phage replisome organizer N-terminal domain-containing protein | - |
| E3S75_RS04710 (E3S75_04710) | - | 937447..938229 (-) | 783 | WP_000240897.1 | AP2 domain-containing protein | - |
| E3S75_RS04715 (E3S75_04715) | - | 938229..938897 (-) | 669 | Protein_905 | putative HNHc nuclease | - |
| E3S75_RS04720 (E3S75_04720) | ssbA | 938909..939367 (-) | 459 | WP_160195134.1 | single-stranded DNA-binding protein | Machinery gene |
| E3S75_RS04725 (E3S75_04725) | - | 939367..939990 (-) | 624 | WP_000139720.1 | DUF1071 domain-containing protein | - |
| E3S75_RS04730 (E3S75_04730) | - | 939983..940204 (-) | 222 | WP_000815401.1 | DUF2483 family protein | - |
| E3S75_RS04735 (E3S75_04735) | - | 940214..940474 (-) | 261 | WP_000291089.1 | DUF1108 family protein | - |
| E3S75_RS04740 (E3S75_04740) | - | 940571..940732 (-) | 162 | WP_000066011.1 | DUF1270 domain-containing protein | - |
| E3S75_RS13770 | - | 940725..940853 (-) | 129 | WP_001559112.1 | hypothetical protein | - |
| E3S75_RS04745 (E3S75_04745) | - | 940912..941142 (+) | 231 | WP_000395455.1 | hypothetical protein | - |
| E3S75_RS04750 (E3S75_04750) | - | 941346..941540 (-) | 195 | WP_000390105.1 | hypothetical protein | - |
| E3S75_RS04755 (E3S75_04755) | - | 941557..942345 (-) | 789 | WP_001148566.1 | phage antirepressor | - |
| E3S75_RS04760 (E3S75_04760) | - | 942361..942579 (-) | 219 | WP_001198672.1 | helix-turn-helix transcriptional regulator | - |
| E3S75_RS04765 (E3S75_04765) | - | 942721..943440 (+) | 720 | WP_000358224.1 | XRE family transcriptional regulator | - |
| E3S75_RS04770 (E3S75_04770) | - | 943476..944156 (+) | 681 | WP_000392109.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| E3S75_RS04775 (E3S75_04775) | - | 944363..945748 (+) | 1386 | WP_000861313.1 | recombinase family protein | - |
Sequence
Protein
Download Length: 152 a.a. Molecular weight: 16997.75 Da Isoelectric Point: 8.4362
>NTDB_id=416633 E3S75_RS04720 WP_160195134.1 938909..939367(-) (ssbA) [Staphylococcus aureus strain UP_378]
MLNRAVLVGRLTKDPELRSTPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYQQQHNSYNAPQNRQQSNNPFANANGPIEISDDDLPF
MLNRAVLVGRLTKDPELRSTPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYQQQHNSYNAPQNRQQSNNPFANANGPIEISDDDLPF
Nucleotide
Download Length: 459 bp
>NTDB_id=416633 E3S75_RS04720 WP_160195134.1 938909..939367(-) (ssbA) [Staphylococcus aureus strain UP_378]
ATGTTAAACAGAGCAGTATTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCACACCAAATGGCGTAAATGTAGG
AACATTCACATTAGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAAAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGACTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCAACAACAGCATAATTCATATAACGCACCACAGAATAGACAGCAATCAAATA
ATCCATTTGCTAATGCTAATGGTCCTATAGAAATCTCTGACGATGATTTACCTTTCTAG
ATGTTAAACAGAGCAGTATTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCACACCAAATGGCGTAAATGTAGG
AACATTCACATTAGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAAAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGACTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCAACAACAGCATAATTCATATAACGCACCACAGAATAGACAGCAATCAAATA
ATCCATTTGCTAATGCTAATGGTCCTATAGAAATCTCTGACGATGATTTACCTTTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
62.209 |
100 |
0.704 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
52.941 |
100 |
0.592 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
69.737 |
0.414 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.382 |
| ssb | Neisseria meningitidis MC58 |
32.759 |
100 |
0.375 |
| ssb | Neisseria gonorrhoeae MS11 |
32.759 |
100 |
0.375 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
47.826 |
75.658 |
0.362 |