Detailed information
Overview
| Name | comC/comC1 | Type | Regulator |
| Locus tag | GOM47_RS09615 | Genome accession | NZ_CP046524 |
| Coordinates | 1940785..1940913 (-) | Length | 42 a.a. |
| NCBI ID | WP_081102474.1 | Uniprot ID | A0A139M7G0 |
| Organism | Streptococcus oralis strain SOT | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1935785..1945913
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GOM47_RS09590 (GOM47_09590) | - | 1937904..1938446 (+) | 543 | WP_235080667.1 | TetR/AcrR family transcriptional regulator | - |
| GOM47_RS09605 (GOM47_09605) | comE | 1938687..1939439 (-) | 753 | WP_084948177.1 | competence system response regulator transcription factor ComE | Regulator |
| GOM47_RS09610 (GOM47_09610) | comD | 1939436..1940773 (-) | 1338 | WP_235080668.1 | competence system sensor histidine kinase ComD | Regulator |
| GOM47_RS09615 (GOM47_09615) | comC/comC1 | 1940785..1940913 (-) | 129 | WP_081102474.1 | competence-stimulating peptide ComC | Regulator |
| GOM47_RS09625 (GOM47_09625) | rlmH | 1941194..1941673 (-) | 480 | WP_235080669.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| GOM47_RS09630 (GOM47_09630) | htrA | 1941857..1943047 (+) | 1191 | WP_235080670.1 | S1C family serine protease | Regulator |
| GOM47_RS09635 (GOM47_09635) | spo0J | 1943105..1943863 (+) | 759 | WP_235080671.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Sequence
Protein
Download Length: 42 a.a. Molecular weight: 5021.92 Da Isoelectric Point: 10.4867
>NTDB_id=405025 GOM47_RS09615 WP_081102474.1 1940785..1940913(-) (comC/comC1) [Streptococcus oralis strain SOT]
MKNTVKLEQFKEVTEAELQEIRGGDKRGLMDLFKQIPIFRRK
MKNTVKLEQFKEVTEAELQEIRGGDKRGLMDLFKQIPIFRRK
Nucleotide
Download Length: 129 bp
>NTDB_id=405025 GOM47_RS09615 WP_081102474.1 1940785..1940913(-) (comC/comC1) [Streptococcus oralis strain SOT]
ATGAAAAACACAGTTAAATTGGAACAATTTAAAGAAGTAACAGAGGCAGAATTGCAGGAGATTCGGGGTGGAGATAAAAG
AGGATTAATGGATCTTTTCAAGCAAATTCCTATTTTTAGGAGAAAATAA
ATGAAAAACACAGTTAAATTGGAACAATTTAAAGAAGTAACAGAGGCAGAATTGCAGGAGATTCGGGGTGGAGATAAAAG
AGGATTAATGGATCTTTTCAAGCAAATTCCTATTTTTAGGAGAAAATAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC1 | Streptococcus pneumoniae Rx1 |
50 |
100 |
0.5 |
| comC/comC1 | Streptococcus pneumoniae R6 |
50 |
100 |
0.5 |
| comC/comC1 | Streptococcus pneumoniae G54 |
50 |
100 |
0.5 |
| comC/comC1 | Streptococcus pneumoniae D39 |
50 |
100 |
0.5 |
| comC | Streptococcus mitis SK321 |
66.667 |
64.286 |
0.429 |
| comC | Streptococcus mitis NCTC 12261 |
42.857 |
100 |
0.429 |
| comC/comC2 | Streptococcus pneumoniae A66 |
62.963 |
64.286 |
0.405 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
62.963 |
64.286 |
0.405 |