Detailed information NTG0405000

Bioinformatically predicted

Overview

• Name: clpP
• Type: Regulator
• Locus tag: GOM47_RS06960
• Genome accession: NZ_CP046524
• Coordinates: 1366825..1367415 (-)
• Length: 196 a.a.
• NCBI ID: WP_000613470.1
• Uniprot ID: A0A139PFB2
• Organism: Streptococcus oralis strain SOT
• Function: degradation of ComX; degradation of ComW (predicted from homology) Competence regulation

Genomic Context

Location: 1361825..1372415

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
GOM47_RS06935 (GOM47_06930)	-	1362516..1363280 (-)	765	WP_235080310.1	ABC transporter ATP-binding protein	-
GOM47_RS06940 (GOM47_06935)	-	1363280..1364236 (-)	957	WP_000856261.1	branched-chain amino acid ABC transporter permease	-
GOM47_RS06945 (GOM47_06940)	-	1364240..1365109 (-)	870	WP_235080311.1	branched-chain amino acid ABC transporter permease	-
GOM47_RS06950 (GOM47_06945)	-	1365228..1366388 (-)	1161	WP_235080312.1	ABC transporter substrate-binding protein	-
GOM47_RS06955 (GOM47_06950)	-	1366476..1366745 (-)	270	WP_061597844.1	YlbG family protein	-
GOM47_RS06960 (GOM47_06955)	clpP	1366825..1367415 (-)	591	WP_000613470.1	ATP-dependent Clp protease proteolytic subunit ClpP	Regulator
GOM47_RS06965 (GOM47_06960)	upp	1367593..1368222 (-)	630	WP_084926127.1	uracil phosphoribosyltransferase	-
GOM47_RS06970 (GOM47_06965)	-	1368311..1368778 (-)	468	WP_235080313.1	deoxycytidylate deaminase	-
GOM47_RS06975 (GOM47_06970)	-	1368797..1369354 (-)	558	WP_235080314.1	TetR/AcrR family transcriptional regulator	-
GOM47_RS06980 (GOM47_06975)	-	1369479..1370324 (+)	846	WP_235080315.1	DegV family protein	-
GOM47_RS06985 (GOM47_06980)	-	1370382..1371557 (+)	1176	WP_235080316.1	NAD(P)/FAD-dependent oxidoreductase	-
GOM47_RS06990 (GOM47_06985)	-	1371577..1372032 (+)	456	WP_235080317.1	8-oxo-dGTP diphosphatase	-

Sequence

Protein

• Length: 196 a.a.
• Molecular weight: 21348.39 Da
• Isoelectric Point: 4.5654

>NTDB_id=405000 GOM47_RS06960 WP_000613470.1 1366825..1367415(-) (clpP) [Streptococcus oralis strain SOT]
MIPVVIEQTSRGERSYDIYSRLLKDRIIMLTGPVEDNMANSVIAQLLFLDAQDSTKDIYLYVNTPGGSVSAGLAIVDTMN
FIKADVQTIVMGMAASMGTVIASSGAKGKRFMLPNAEYMIHQPMGGTGGGTQQTDMAIAAEHLLKTRKTLEQILATNSGK
SVEQIHADAERDYWMSAQETLEYGFIDEIMANNSLS

Nucleotide

• Length: 591 bp

>NTDB_id=405000 GOM47_RS06960 WP_000613470.1 1366825..1367415(-) (clpP) [Streptococcus oralis strain SOT]
ATGATTCCTGTAGTTATTGAACAAACAAGCCGTGGAGAACGTTCCTATGACATATACTCTCGTCTTCTGAAAGATCGCAT
CATCATGCTAACAGGTCCGGTTGAAGATAACATGGCTAACTCCGTTATCGCCCAGTTGCTCTTCTTGGATGCCCAAGACA
GTACAAAAGATATTTACCTTTATGTCAACACACCTGGAGGCTCTGTTTCAGCTGGTTTGGCAATCGTTGATACCATGAAC
TTTATCAAGGCAGATGTCCAAACAATCGTTATGGGGATGGCTGCATCCATGGGGACTGTCATTGCATCAAGTGGCGCAAA
AGGCAAACGTTTCATGCTTCCAAATGCAGAGTACATGATTCACCAACCAATGGGTGGAACAGGTGGTGGTACCCAACAGA
CAGATATGGCAATCGCTGCAGAGCACTTGCTTAAAACTCGTAAGACTTTGGAGCAAATCCTTGCGACTAACTCAGGTAAA
TCAGTTGAGCAAATTCATGCAGATGCAGAACGTGATTACTGGATGAGTGCCCAAGAAACGCTCGAATATGGCTTCATTGA
TGAAATCATGGCTAACAATTCTTTGAGCTAA

Domains

Predicted by InterproScan.

• Clp protease (CLP_protease) (11-192)

3D structure

• AlphaFold DB: A0A139PFB2

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
clpP	Streptococcus pneumoniae Rx1	95.408	100	0.954
clpP	Streptococcus pneumoniae D39	95.408	100	0.954
clpP	Streptococcus pneumoniae R6	95.408	100	0.954
clpP	Streptococcus pneumoniae TIGR4	95.408	100	0.954
clpP	Streptococcus pyogenes MGAS315	92.308	99.49	0.918
clpP	Streptococcus pyogenes JRS4	92.308	99.49	0.918
clpP	Streptococcus thermophilus LMD-9	90.769	99.49	0.903
clpP	Streptococcus thermophilus LMG 18311	90.769	99.49	0.903
clpP	Streptococcus mutans UA159	88.205	99.49	0.878
clpP	Lactococcus lactis subsp. lactis strain DGCC12653	87.179	99.49	0.867
clpP	Lactococcus lactis subsp. cremoris KW2	86.667	99.49	0.862
clpP	Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819	58.031	98.469	0.571
clpP	Bacillus subtilis subsp. subtilis str. 168	57.292	97.959	0.561